* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
Download Bioinformatics Tools
Ridge (biology) wikipedia , lookup
Gene therapy wikipedia , lookup
Epigenetics of diabetes Type 2 wikipedia , lookup
Copy-number variation wikipedia , lookup
Point mutation wikipedia , lookup
Biology and consumer behaviour wikipedia , lookup
Gene desert wikipedia , lookup
Genomic imprinting wikipedia , lookup
Gene nomenclature wikipedia , lookup
Vectors in gene therapy wikipedia , lookup
Gene expression programming wikipedia , lookup
No-SCAR (Scarless Cas9 Assisted Recombineering) Genome Editing wikipedia , lookup
Epigenetics of human development wikipedia , lookup
Epigenetics of neurodegenerative diseases wikipedia , lookup
Transposable element wikipedia , lookup
Oncogenomics wikipedia , lookup
Genetic engineering wikipedia , lookup
Nutriepigenomics wikipedia , lookup
Whole genome sequencing wikipedia , lookup
Genomic library wikipedia , lookup
Non-coding DNA wikipedia , lookup
Genome (book) wikipedia , lookup
Microevolution wikipedia , lookup
Metagenomics wikipedia , lookup
Human genome wikipedia , lookup
Therapeutic gene modulation wikipedia , lookup
History of genetic engineering wikipedia , lookup
Gene expression profiling wikipedia , lookup
Public health genomics wikipedia , lookup
Designer baby wikipedia , lookup
Site-specific recombinase technology wikipedia , lookup
Pathogenomics wikipedia , lookup
Minimal genome wikipedia , lookup
Human Genome Project wikipedia , lookup
Genome editing wikipedia , lookup
Artificial gene synthesis wikipedia , lookup
Introduction to Bioinformatics 236523/234525 Lecturer: Prof. Yael Mandel-Gutfreund Teaching Assistance: Shai Ben-Elazar Idit kosti Course web site : http://webcourse.cs.technion.ac.il/236523 What is Bioinformatics? 2 Course Objectives • To introduce the bioinfomatics discipline • To make the students familiar with the major biological questions which can be addressed by bioinformatics tools • To introduce the major tools used for sequence and structure analysis and explain in general how they work (limitation etc..) 3 Course Structure and Requirements 1.Class Structure 1. 2. 2 hours Lecture 1 hour tutorial 2. Home work • Homework assignments will be given every second week • The homework will be done in pairs. • 5/5 homework assignments will be submitted 2. A final project will be conducted in pairs * Project will be presented as a poster –poster day 14.3 4 Grading • 20 % Homework assignments • 80 % final project 5 Literature list • Gibas, C., Jambeck, P. Developing Bioinformatics Computer Skills. O'Reilly, 2001. • Lesk, A. M. Introduction to Bioinformatics. Oxford University Press, 2002. • Mount, D.W. Bioinformatics: Sequence and Genome Analysis. 2nd ed.,Cold Spring Harbor Laboratory Press, 2004. Advanced Reading Jones N.C & Pevzner P.A. An introduction to Bioinformatics algorithms MIT Press, 2004 6 What is Bioinformatics? 7 What is Bioinformatics? “The field of science in which biology, computer science, and information technology merge to form a single discipline” Ultimate goal: to enable the discovery of new biological insights as well as to create a global perspective from which unifying principles in biology can be discerned. 8 Central Paradigm in Molecular Biology Gene (DNA) mRNA Protein 21ST centaury Genome Transcriptome Proteome 9 From DNA to Genome Watson and Crick DNA model 1955 1960 1965 1970 1975 1980 1985 10 1990 First genome Hemophilus Influenzae 1995 Yeast genome 2000 First human genome draft 11 Complete Genomes Total 2010 1379 2005 294 Eukaryotes 133 39 Bacteria 1152 235 Archaea 94 23 12 1,000 Genomes Project: Expanding the Map of Human Genetics Researchers hope the effort will speed up the discovery of many diseases's genetic roots 13 25000 genomes… What’s Next ? The “post-genomics” era Annotation Comparative genomics Functional genomics Systems Biology Main Goal: To understand the living cell 14 From ….25000 genomes To…Understanding living cells Annotation CCTGACAAATTCGACGTGCGGCATTGCATGCAGACGTGCATG CGTGCAAATAATCAATGTGGACTTTTCTGCGATTATGGAAGAA CTTTGTTACGCGTTTTTGTCATGGCTTTGGTCCCGCTTTGTTC AGAATGCTTTTAATAAGCGGGGTTACCGGTTTGGTTAGCGAGA AGAGCCAGTAAAAGACGCAGTGACGGAGATGTCTGATG CAA TAT GGA CAA TTG GTT TCT TCT CTG AAT ...... .............. TGAAAAACGTA 16 Identify the genes within a given sequence of DNA Identify the sites Which regulate the gene Annotation Predict the function 17 How do we identify a gene in a genome? A gene is characterized by several features (promoter, ORF…) some are easier and some harder to detect… 18 TF binding site CCTGACAAATTCGACGTGCGGCATTGCATGCAGACGTGCATG CGTGCAAATAATCAATGTGGACTTTTCTGCGATTATGGAAGAA CTTTGTTACGCGTTTTTGTCATGGCTTTGGTCCCGCTTTGTTC AGAATGCTTTTAATAAGCGGGGTTACCGGTTTGGTTAGCGAGA AGAGCCAGTAAAAGACGCAGTGACGGAGATGTCTGATG CAA TAT GGA CAA TTG GTT TCT TCT CTG AAT ................................. Transcription Start Site promoter .............. TGAAAAACGTA ORF=Open Reading Frame Ribosome binding Site CDS=Coding Sequence 19 Using Bioinformatics approaches for Gene hunting Relative easy in simple organisms (e.g. bacteria) VERY HARD for higher organism (e.g. humans) 20 Comparative genomics 21 Perhaps not surprising!!! How humans are chimps? Comparison between the full drafts of the human and chimp genomes revealed that they differ only by 1.23% 22 So where are we different ?? Human Chimp Mouse ATAGCGGGGGGATGCGGGCCCTATACCC ATAGGGGGGATGCGGGCCCTATACCC ATAGCGGGATGCGGCGCTATACCA Human Chimp Mouse ATAGCGGGGGGATGCGGGCCCTATACCC ATAGGGG--GGATGCGGGCCCTATACCC ATAGCG---GGATGCGGCGC-TATACC-A 23 And where are we similar ??? VERY DIFFERENT VERY SIMAILAR Conserved between many organisms 24 Functional genomics 25 TO BE IS NOT ENOUGH In any time point a gene can be functional or not 26 From the gene expression pattern we can lean: What does the gene do ? When is it needed? What other genes or proteins interact with it? ….. What's wrong?? 27 Systems Biology 28 Biological networks Jeong et al. Nature 411, 41 - 42 (2001) What can we learn from a network? What can we learn from Biological Networks What can we learn about this protein • Is the protein essential for the organism ? • Is it a good drug targets? What of all this will we learn in the course? The course will concentrate on the bioinformatics tools and databases which are used to : Annotate genes, Compare genes and genomes Infer the function of the genes and proteins Analyze the interactions between genes and proteins ETC…. 32 Biological Databases The different types of data are collected in database – Sequence databases – Structural databases – Databases of Experimental Results All databases are connected 33 Sequence databases • • • • Gene database Genome database Disease related mutation database …………. 34 Genome Browsers Easy “walk” through the genome UCSC Genome Browser http://genome.ucsc.edu/ 35 Disease related database 36 Sickle Cell Anemia • Due to 1 swapping an A for a T, causing inserted amino acid to be valine instead of glutamine in hemoglobin Image source: http://www.cc.nih.gov/ccc/ccnews/nov99/ 37 Healthy Individual >gi|28302128|ref|NM_000518.4| Homo sapiens hemoglobin, beta (HBB), mRNA ACATTTGCTTCTGACACAACTGTGTTCACTAGCAACCTCAAACAGACACCATGGTGCATCTGACTCCTGA GGAGAAGTCTGCCGTTACTGCCCTGTGGGGCAAGGTGAACGTGGATGAAGTTGGTGGTGAGGCCCTGGGC AGGCTGCTGGTGGTCTACCCTTGGACCCAGAGGTTCTTTGAGTCCTTTGGGGATCTGTCCACTCCTGATG CTGTTATGGGCAACCCTAAGGTGAAGGCTCATGGCAAGAAAGTGCTCGGTGCCTTTAGTGATGGCCTGGC TCACCTGGACAACCTCAAGGGCACCTTTGCCACACTGAGTGAGCTGCACTGTGACAAGCTGCACGTGGAT CCTGAGAACTTCAGGCTCCTGGGCAACGTGCTGGTCTGTGTGCTGGCCCATCACTTTGGCAAAGAATTCA CCCCACCAGTGCAGGCTGCCTATCAGAAAGTGGTGGCTGGTGTGGCTAATGCCCTGGCCCACAAGTATCA CTAAGCTCGCTTTCTTGCTGTCCAATTTCTATTAAAGGTTCCTTTGTTCCCTAAGTCCAACTACTAAACT GGGGGATATTATGAAGGGCCTTGAGCATCTGGATTCTGCCTAATAAAAAACATTTATTTTCATTGC >gi|4504349|ref|NP_000509.1| beta globin [Homo sapiens] EEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLG MVHLTP AFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVAN ALAHKYH 38 Diseased Individual >gi|28302128|ref|NM_000518.4| Homo sapiens hemoglobin, beta (HBB), mRNA ACATTTGCTTCTGACACAACTGTGTTCACTAGCAACCTCAAACAGACACCATGGTGCATCTGACTCCTGA GGTGAAGTCTGCCGTTACTGCCCTGTGGGGCAAGGTGAACGTGGATGAAGTTGGTGGTGAGGCCCTGGGC AGGCTGCTGGTGGTCTACCCTTGGACCCAGAGGTTCTTTGAGTCCTTTGGGGATCTGTCCACTCCTGATG CTGTTATGGGCAACCCTAAGGTGAAGGCTCATGGCAAGAAAGTGCTCGGTGCCTTTAGTGATGGCCTGGC TCACCTGGACAACCTCAAGGGCACCTTTGCCACACTGAGTGAGCTGCACTGTGACAAGCTGCACGTGGAT CCTGAGAACTTCAGGCTCCTGGGCAACGTGCTGGTCTGTGTGCTGGCCCATCACTTTGGCAAAGAATTCA CCCCACCAGTGCAGGCTGCCTATCAGAAAGTGGTGGCTGGTGTGGCTAATGCCCTGGCCCACAAGTATCA CTAAGCTCGCTTTCTTGCTGTCCAATTTCTATTAAAGGTTCCTTTGTTCCCTAAGTCCAACTACTAAACT GGGGGATATTATGAAGGGCCTTGAGCATCTGGATTCTGCCTAATAAAAAACATTTATTTTCATTGC >gi|4504349|ref|NP_000509.1| beta globin [Homo sapiens] VEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLG MVHLTP AFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVAN ALAHKYH 39 Structure Databases • 3-dimensional structures of proteins, nucleic acids, molecular complexes etc • 3-d data is available due to techniques such as NMR and X-Ray crystallography 40 41 Databases of Experimental Results • Data such as experimental microarray images- gene expression data • Proteomic data- protein expression data • Metabolic pathways, protein-protein interaction data, regulatory networks • ETC…………. 42 Literature Databases PubMed http://www.ncbi.nlm.nih.gov/pubmed/ Service of the National Library of Medicine 43 Putting it all Together • Each Database contains specific information • Like other biological systems also these databases are interrelated 44 PROTEIN PIR DISEASE ASSEMBLED GENOMES LocusLink SWISS-PROT OMIM GoldenPath OMIA WormBase MOTIFS TIGR BLOCKS Pfam GENOMIC DATA Prosite GenBank ESTs dbEST DDBJ GENES EMBL RefSeq unigene AllGenes SNPs GENE EXPRESSION dbSNP STRUCTURE PDB MMDB SCOP PATHWAY Stanford MGDB KEGG NetAffx COG ArrayExpress GDB LITERATURE PubMed 45