* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Download Ascona B-DNA Consortium
Endogenous retrovirus wikipedia , lookup
Promoter (genetics) wikipedia , lookup
Zinc finger nuclease wikipedia , lookup
DNA repair protein XRCC4 wikipedia , lookup
DNA sequencing wikipedia , lookup
Genetic engineering wikipedia , lookup
Restriction enzyme wikipedia , lookup
Real-time polymerase chain reaction wikipedia , lookup
Agarose gel electrophoresis wikipedia , lookup
Genomic library wikipedia , lookup
DNA profiling wikipedia , lookup
Point mutation wikipedia , lookup
Biosynthesis wikipedia , lookup
Community fingerprinting wikipedia , lookup
SNP genotyping wikipedia , lookup
Bisulfite sequencing wikipedia , lookup
Maurice Wilkins wikipedia , lookup
Vectors in gene therapy wikipedia , lookup
Gel electrophoresis of nucleic acids wikipedia , lookup
Molecular cloning wikipedia , lookup
Transformation (genetics) wikipedia , lookup
Non-coding DNA wikipedia , lookup
Artificial gene synthesis wikipedia , lookup
DNA supercoil wikipedia , lookup
DNA: Structure, Dynamics and Recognition Richard Lavery Institut de Biologie Physico-Chimique, Paris Les Houches 2004 L1: Biological context, history, basic DNA structure L2: Introductory DNA biophysics and biology L3: DNA dynamics L4: DNA deformation L5: Recognizing DNA Les Houches 2004 DNA: Structure, Dynamics and Recognition L1: Biological context, history, basic DNA structure Les Houches 2004 BIOLOGICAL CONTEXT 140 Mb 3300 Mb 4.4 Mb 0.6 Mb 4.6 Mb 50 mm VEVRLREDPETFLVQLYQHCPPLARIDSVEREPFIWSQLPTEFTIRQSTGGTMNTQIVP FT DAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACD FT KEYRDPLDRRFHAQPVACPECGPHLEWVSHGEHAEQEAALQAAIAQLKMGKIVAIKGIG F GFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKK FT YVPELCDDIAPDLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALAD FT LQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGA F DLKNTFCLVRGEQAVLSQHLGDLSDDGIQMQWREALRLMQNIYDFTPQYVVHDAHPGYV SSQWAREMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGEC LRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYSETASVQQQNWS VLARAIERGINAPLASSCGRFFDAVAAALGCAPATLSYEGEAACALEALAASCHGVTHP FT VTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLV Escherichia Coli, ≈4.6 Mb 500 Å E. coli membrane region © David S. Goodsell • DNA • Double helix • Stores genetic code as a linear sequence of bases • ≈ 20 Å in diameter • Human genome ≈ 3.3 x 109 bp • ≈ 25,000 genes Chemical bond 1Å (10-10 m) Amino acid 10 Å (10-9 m) Globular protein 100 Å (10-8 m) Virus 1000 Å (10-7 m) Cell nucleus 1 mm (10-6 m) Bacterial cell 5 mm (10-5 m) Chromosome DNA 10 cm (10-1 m) Biological length scale If 20 Å 1 cm then ... 1 m 5000 km ... Nucleus 15 m2 room Biological length scale A "minimal" organism "We are wondering if we can come up with a molecular definition of life" "The goal is to fundamentally understand the components of the most basic living cell" Craig Venter, founder of Celera Genomics, IBEA and several other gene tech companies Hutchinson et al. Science 286, 1999, 2165 K.C. Chen et al. Mol. Biol. Cell Cycle 11 (2000) 369 Modelling the budding yeast cell cycle (Tyson & Novak) 580,000 bp 500 genes E-cell project Molecular machines .... transcriptosome Nanobiotechnology D.S. Goodsell Nucleosome A LITTLE HISTORY ... 1865 Gregor Mendel publishes his work on plant breeding with the notion of "genes" carrying transmissible characteristics 1869 "Nuclein" is isolated by Johann Friedrich Miescher à Tübingen in the laboratory of Hoppe-Seyler 1892 Meischer writes to his uncle "large biological molecules composed of small repeated chemical pieces could express a rich language in the same way as the letters of our alphabet" 1920 Recognition of the chemical difference between DNA and RNA Phoebus Levene proposes the "tetranucleotide hypothesis" 1938 William Astbury obtains the first diffraction patters of DNA fibres History of DNA 1944 Oswald Avery (Rockefeller Institute) proves that DNA carries the genetic message by transforming bacteria History of DNA 1950 Erwin Chargaff discovers A/G = T/C History of DNA 1953 Watson and Crick propose the double helix as the structure of DNA based on the work of Erwin Chargaff, Jerry Donohue, Rosy Franklin and John Kendrew History of DNA Maurice Wilkins – Kings College, London Rosalind Franklin (in Paris) X-ray fibre diffraction pattern of B-DNA Linus Pauling’s DNA Thymine -Adenine Cytosine -Guanine Watson-Crick base pairs Watson and Crick It has not escaped our notice that the specific pairing we have postulated suggests a possible copying mechanism for the genetic material. It has not escaped our notice … Double helix ? Dickerson Dodecamer (Oct. 1980) DNA STRUCTURE OH ribose H deoxyribose Nucleoside Nucleotide Nucleotide triphosphates Nucleotides are linked by phosphodiester bonds Strand has a direction (5'3') RNA : A,U,G,C + ribose DNA : A ,T,G,C + deoxyribose DNA/RNA chemical structure N7 C5 C4 C6 C8 N1 N9 C6 N3 C2 C4 C5 N1 C2 N3 Purine (Pur / R) Pyrimidine (Pyr / Y) Base families Thymine -Adenine Cytosine -Guanine Watson-Crick base pairs Base pair dimensions 20 Å GC AT CG CGCGTTGACAACTGCAGAATC 34 Å TA TA GC AT Major Groove TA 3.4 Å Strands are antiparallel Minor Groove CG CG GC AT GC Hydration 5’ 3’ 3’ 5’ Antiparallel strands B A A and B DNA allomorphs DNA grooves B-DNA (longitudinal view) R.H. helix B-DNA (lateral view) A-DNA (longitudinal view) R.H. helix A-DNA (lateral view) Z-DNA (longitudinal view) L.H. helix Z-DNA (lateral view) Base pairs are rotated in Z-DNA n0 Backbone dihedrals - I +10° +60° Staggered Eclipsed Dihedral angle definition gauche + gauche - trans Favoured conformations : O3’ – P – O5’ – C5’ g- : P – O5’ – C5’ – C4’ t g: O5’ – C5’ – C4’ – C3’ g+ : C5’ – C4’ – C3’ – O3’ g+ e: C4’ – C3’ – O3’ – P t z: C3’ – O3’ – P – O5’ g- (Y) : O4’ – C1’ – N1 – C2 (R) : O4’ – C1’ – N9 – C4 Backbone dihedrals - II g- syn-anti glycosidic conformations Baird & Tatlock 1901 Medicine Sets Manufactures by Messrs Burroughs, Wellcome & Co. C5’ Base ENDO EXO Sugar ring puckering Sugar pucker described as pseudorotation North : C3’-endo East : O4’-endo South : C3’-endo "2 B or not 2 B ...." W. Shakespeare 1601 tan P = (n4 - n1) - (n3 - n0) n4 n0 2n2 (Sin 36° + Sin72°) n1 n3 Amp = n2 / Cos P n2 Pseudorotation Equations Altona et al. J. Am. Chem. Soc. 94, 1972, 8205 Base Preferred sugar puckers Sugar pucker and P-P distance UNUSUAL DNA STRUCTURES Reversed Watson-Crick Watson-Crick Hoogsteen Reversed Hoogsteen Alternative base pairs - note C(N3) protonation Watson-Crick + Hoogsteen = Base triplet Triple helix DNA Guanine Hoogsteen pairing Base tetraplex Quadruplex DNA Inverted repeat can lead to loop formation Holliday junction DNA cruciform PNA versus DNA Achiral, peptide-like backbone Backbone is uncharged High thermal stability High-specificity hybridization with DNA Resistant to enzymatic degradation Can displace DNA strand of duplex Pyrimidine PNA strands can form 2:1 triplexes with ssDNA Biotechnological applications Peptide Nucleic acid(PNA) Parallel-stranded DNA I-DNA: intercalated parallel-stranded duplexes and nucleotide anomers H OH is not the only change in passing from DNA to RNA .... Principles of Nucleic Acid Structure, W. Saenger, 1984 Springer-Verlag Nucleic Acid Structure, Ed. S. Neidle, 1999 Oxford University Press DNA Structure and Function, R.R. Sinden, 1994 Academic Press Biochemistry, D. Voet and J.G. Voet, 1998 DeBoeck The Eighth Day of Creation, H.F. Judson, 1996 Cold Spring Harbour Press Books on DNA