* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Download Lecture 16-LC710 Posted
DNA barcoding wikipedia , lookup
RNA polymerase II holoenzyme wikipedia , lookup
Gene expression wikipedia , lookup
DNA sequencing wikipedia , lookup
Comparative genomic hybridization wikipedia , lookup
Promoter (genetics) wikipedia , lookup
Agarose gel electrophoresis wikipedia , lookup
Maurice Wilkins wikipedia , lookup
Silencer (genetics) wikipedia , lookup
Molecular evolution wikipedia , lookup
Eukaryotic transcription wikipedia , lookup
Transcriptional regulation wikipedia , lookup
Gel electrophoresis of nucleic acids wikipedia , lookup
Genomic library wikipedia , lookup
Transformation (genetics) wikipedia , lookup
Vectors in gene therapy wikipedia , lookup
Restriction enzyme wikipedia , lookup
Non-coding DNA wikipedia , lookup
Biosynthesis wikipedia , lookup
SNP genotyping wikipedia , lookup
DNA supercoil wikipedia , lookup
Molecular cloning wikipedia , lookup
Nucleic acid analogue wikipedia , lookup
Bisulfite sequencing wikipedia , lookup
Cre-Lox recombination wikipedia , lookup
Community fingerprinting wikipedia , lookup
710.LC GRADUATE MOLECULAR BIOLOGY 10/31/2011 Lecture 4 Competency Test. Enzyme Site Recognition Restriction site Palindrome • Each enzyme digests (cuts) DNA at a specific sequence = restriction site • Enzymes recognize 4- or 6- base pair, palindromic sequences (eg GAATTC) Fragment 1 Fragment 2 5 vs 3 Prime Overhang • Generates 5 prime overhang Enzyme cuts Common Restriction Enzymes EcoRI – Eschericha coli – 5 prime overhang Pstl – Providencia stuartii – 3 prime overhang 1) Name the five components of a PCR reaction. 1) Template 2) Buffer 3) Primers (two of them) 4) Taq Polymerase 5) dNTPs The PCR Reaction How does it work? Heat (94oC) to denature DNA strands Cool (52oC) to anneal primers to template Warm (72oC) to activate Taq polymerase, which extends primers and replicates DNA Repeat 35 cycles Denaturing Template DNA Heat causes DNA 5’ strands to separate 3’ 3’ 5’ Denaturation of DNA at 94oC 5’ 3’ 3’ 5’ Annealing Primers Primers anneal at 52oC Primers bind to the template 5’ 3’ 5’ 3’ 3’ 5’ 5’ 3’ Taq polymerase recognizes 3’ end of primer + template strand Taq extends at 72oC 5’ 3’ 5’ 3’ 3’ 3’ 5’ 5’ Taq polymerase extends….. Cycle 1 DNA is replicated Repeat denaturing, annealing, and extending 35 cycles Cycle 2 Cycle 3 The exact-length target product is made in the third cycle 2) Name two ways to synthesize a gene. 1) Recombinant PCR Also: Polymerase cycle assembly 2) Assembly PCR Polymerase cycle assembly Assembly PCR What is Nested PCR? 3) What is the purpose of codon optimizing genes? To maximize the translation to the host tRNA population You must know single letter codes What does Degree of Degeneracy Reflect? http://www.encorbio.com/protocols/Codon.htm eGFP MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICT TGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHN VYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK* eGFP (eucaryotic vs for bacterial expression) 4) What are the 3 common components of plasmids used in DNA cloning? 1) Origin [OriC] of replication 2) Selectable marker [I.e. Kan Resistance Gene/Amp Resistance Gene 3) Multiple Cloning Site [MCS] 5) What is the difference between an oligonucleotide and a primer? Nothing. It is the usage which differs. A primer is always used with a polymerase. An oligo is simply a chain of nucleotides 6) Are oligonucleotides and primers single stranded? Yes. We use them to anneal to other single stranded templates. 7) Do oligonucleotides and primers have to be DNA? No. They can be RNA. Why do we use RNA sometimes: Because annealing RNA to DNA Make very stronger hybrids. 8) Name 4 parameters that affect annealing of two single stranded DNA chains? 1)Temperature 2) Salt concentration 3) DNA concentration 4) Length of complementarity 5) Time of re-annealing 9) What does DNA ligase do? DNA ligase catalyzes the Phosphodiester bond formation between two nucleotides. ATP is used in the reaction to donate a phosphate. DNA Ligase Covalently Closes Nicks in DNA DNA ligase forms a high energy intermediate that Aside: Calf Intestinal Phosphotase? Cut with EcoR1 GAATTC CTTAAG G-OH p-AATTC CTTAA-p HO-G Calf Intestinal Phosphotase? Cut with EcoR1 G-OH CTTAA-p G-OH CTTAA-OH p-AATTC HO-G HO-AATTC HO-G Calf Intestinal Phosphotase? Cut with EcoR1 p-AATTCgatacagagagactcatgacgG-OH HO-GctatgtctctctgagtactgcCTTAA-p G-OH CTTAA-OH HO-AATTC Vector won’t religate, But will take in insert HO-G