* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Download Biol 505 EXAM 1 (100 points): Due Wed 10/14/09 at the beginning
RNA silencing wikipedia , lookup
Gene expression profiling wikipedia , lookup
Saethre–Chotzen syndrome wikipedia , lookup
Metagenomics wikipedia , lookup
Gene therapy wikipedia , lookup
Nucleic acid double helix wikipedia , lookup
Transposable element wikipedia , lookup
Epigenomics wikipedia , lookup
Expanded genetic code wikipedia , lookup
Extrachromosomal DNA wikipedia , lookup
Molecular cloning wikipedia , lookup
Gene expression programming wikipedia , lookup
Cell-free fetal DNA wikipedia , lookup
Epigenetics of human development wikipedia , lookup
Neocentromere wikipedia , lookup
DNA supercoil wikipedia , lookup
Cre-Lox recombination wikipedia , lookup
Human genome wikipedia , lookup
Nutriepigenomics wikipedia , lookup
Genomic library wikipedia , lookup
Frameshift mutation wikipedia , lookup
History of RNA biology wikipedia , lookup
Genetic engineering wikipedia , lookup
Genome evolution wikipedia , lookup
Non-coding RNA wikipedia , lookup
No-SCAR (Scarless Cas9 Assisted Recombineering) Genome Editing wikipedia , lookup
X-inactivation wikipedia , lookup
Non-coding DNA wikipedia , lookup
Genome (book) wikipedia , lookup
Site-specific recombinase technology wikipedia , lookup
Vectors in gene therapy wikipedia , lookup
Microsatellite wikipedia , lookup
Genetic code wikipedia , lookup
History of genetic engineering wikipedia , lookup
Primary transcript wikipedia , lookup
Nucleic acid analogue wikipedia , lookup
Designer baby wikipedia , lookup
Genome editing wikipedia , lookup
Deoxyribozyme wikipedia , lookup
Therapeutic gene modulation wikipedia , lookup
Point mutation wikipedia , lookup
Microevolution wikipedia , lookup
Biol 505 EXAM 1 (100 points): Due Wed 10/14/09 at the beginning of class. Hard copy only. Although this is an open book/open note exam, you are taking this exam under the honor system, which requires that you refrain from sharing any information regarding the exam with any of your classmates. The honor system also requires that you report any infractions of this code to me. Even the appearance of academic dishonesty (e.g., identical wrong answers) will be taken seriously and dealt with accordingly. Please use your own words when answering questions and do not plagiarize from texts or the internet. Part I: Molecular Genetics (60 points) 1. Outline the relations between genes, DNA, and chromosomes. 2. Compare and conrast genotype and phenotype. 3. What is semiconservative replication? 4. Draw a molecule of DNA undergoing eukaryotic linear replication. On your drawing,identify (1) origin, (2) polarity (5’ and 3’ ends) of all template strands and newly synthesized strands, (3) leading and lagging strands, (4) Okazaki fragments, and (5) location of primers. 5. What are the major classes of RNA? Where would you expect to find each class of RNA within eukaryotic cells? 6. Compare and contrast transcription and DNA replication. How are these processes similar and how are they different. 7. The following sequence of nucleotides is found in a single-stranded DNA template: A T T G C C A G A T C A T C C C A A T A G A T. Assume that RNA polymerase proceeds along this template from left to right. Which end of the DNA template is 5’ and which end is 3’ ? Give the sequence and label the 5’ and 3’ ends of the RNA copied from this template DNA. As far as you are able determine the amino acid sequence using the single letter amino acid code. 8. Differentiate between an intron and exon. 9. Chromosome mutations come in two basic forms, those that change the number of chromosomes (individual number and number of whole sets) and those that change the organization of the gene loci on the chromosome. Describe the different types of mutations that change the organization of the gene(s) on the chromosome. 10. Determine which modes of inheritance are possible in the following pedigree. Part II: NCBI Questions. (40 Points) 1. Below is the partial nucleotide sequence of a gene associated with a genetic disorder. TCCTGGCATCAGTTACTGTGTTGACTCACTCAGTGTTGGGATCACTCACTTTCCCCCTACAGGACTCAGA TCTGGGAGGCAATTACCTTCGGAGAAAAACGAATAGGAAAAACTGAAGTGTTACTTTTTTTAAAGCTGCT GAAGTTTGTTGGTTTCTCATTGTTTTTAAGCCTACTGGAGCAATAAAGTTTGAAGAACTTTTACCAGGTT TTTTTTATCGCTGCCTTGATATACACTTTTCAAAATGCTTTGGTGGGAAGAAGTAGAGGACTGTT a. b. c. d. e. f. g. h. What is the name of the gene? On which chromosome and arm is it found. What is the name of the disorder associated with variant forms of this gene? How big is this gene (exons + introns)…how many nucleotides? How big (in number of amino acids) is the resulting protein? When you blast the sequence, how many significant alignments result? What is the expect score for the first significant alignment? Define the expect score? Provide the entire classification/taxonomy for the organism. Using ENTREZ, how many total pubmed entries are associated with this disorder? Blast the nucleotide sequence (above) against the mouse genome. For the most significant alignment: what is the identity? Expect score? How many gaps had to be inserted into the alignment to match up the nucleotides? 2. Below is the partial amino acid sequence of an unknown gene and organism. SGPVCVRERLIEKLTYAPKAGSIPETQPKKVLILGSGGLSIGQAGEFDYSGSQAIKALREEKIQTILINPN IATVQTSKGLADKVYFLPLTKEYVEQVIKAERPNGALLTFGGQTALNCGVELEKAGVFSKYNVKILGTPIT SIIETEDRKIFADRVAEIG Using the best expect score: what is the gene? What is the organism? List the citation where this sequence was published.