* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
Download PDF - SAGE Journals
Protein (nutrient) wikipedia , lookup
Extracellular matrix wikipedia , lookup
G protein–coupled receptor wikipedia , lookup
Endomembrane system wikipedia , lookup
Protein phosphorylation wikipedia , lookup
Magnesium transporter wikipedia , lookup
Signal transduction wikipedia , lookup
Bacterial microcompartment wikipedia , lookup
Protein structure prediction wikipedia , lookup
Nuclear magnetic resonance spectroscopy of proteins wikipedia , lookup
Protein moonlighting wikipedia , lookup
List of types of proteins wikipedia , lookup
Protein–protein interaction wikipedia , lookup
Western blot wikipedia , lookup
Intrinsically disordered proteins wikipedia , lookup
C.S. Giometti et al., Eur. J. Mass Spectrom. 7, 207–217 (2001) 207 Structural Modifications of Methanococcus Jannaschii Flagellin Proteins C.S. Giometti et al., Eur. J. Mass Spectrom. 7, 207–217 (2001) Structural modifications of Methanococcus jannaschii flagellin proteins revealed by proteome analysis Carol S. Giometti,* Sandra L. Tollaksen and Gyorgy Babnigg Biosciences Division, Argonne National Laboratory, 9700 South Cass Avenue, Building 202, Room B117, Argonne, IL 60439, USA. E-mail: [email protected] Claudia I. Reich and Gary J. Olsen Department of Microbiology, University of Illinois at Urbana-Champaign, Urbana, IL, USA Hanjo Lim and John R. Yates, III Mass Spectrometry Group, The Scripps Institute, La Jolla, CA, USA Methanococcus jannaschii is an autotrophic archaeon originally isolated from an oceanic thermal vent. The primary metabolic pathway for energy production in this hyperthermophilic microbe is methanogenesis from H2 and CO2. As an autotroph, M. jannaschii requires only CO2 as a carbon source for synthesizing all necessary biomolecules. Changes in the environmental availability of these molecules can be expected to activate regulatory mechanisms manifested as the up and down regulation of specific genes and the concomitant increase and decrease in abundance of the corresponding proteins. In our analysis of the proteome of M. jannaschii, we have observed significant changes in the abundance of a common subset of predominant proteins in response to reduced H2 concentration, limited ammonium availability and the stage of cell growth (exponential compared with stationary). The masses of tryptic peptides from these proteins match those predicted by M. jannaschii genome open reading frames annotated as flagellin B1 (MJ0891) and flagellin B2 (MJ0892). Multiple proteins with different isoelectric points and molecular weights match each of these proteins and the abundance of these protein variants changes with growth conditions. These data indicate that structural modifications altering both the isoelectric point and size of the M. jannaschii flagellin B1 and B2 proteins occur in response to growth conditions and growth stage of M. jannaschii and further suggest the regulation of M. jannaschii motility through structural modifications of the building blocks of the flagella. Keywords: proteomics, flagellin, archaea, Methanococcus jannaschii Introduction M. jannaschii is an autotrophic hyperthermophile originally isolated from a deep sea hydrothermal vent.1 An obligate anaerobe, M. jannaschii derives energy by using H2 to reduce CO2 to methane (CH4). Analysis of the complete genome sequence of M. jannaschii reveals approximately 1785 proteins, 70% of which have been assigned tentative functions based on DNA sequence similarity with known archaeal, bacterial or eukaryotic proteins.2 This paper is being published jointly in European Journal of Mass Spectrometry and in Proteomics (ISSN 1615-9853). Access to the complete genome sequence and associated annotations for M. jannaschii provides the opportunity to study the proteome of this microbe in detail. In addition to identifying all of the detectable proteins with relative ease, due to the small size of the genome, the metabolism of this microbe is amenable to investigation through manipulation of its growth environment. The metabolic dependency of M. jannaschii on H2 for energy metabolism, for example, suggests that deprivation of H2 should activate a cellular response designed to protect existing energy stores and to seek sources of H2. In experiments designed to grow M. jannaschii in the presence of lower than normal H2 partial pressure, we have observed quantitative changes in a number of proteins. The masses of tryptic peptides from these 208 Structural Modifications of Methanococcus Jannaschii Flagellin Proteins proteins have revealed changes in the abundance, not only of proteins known to be involved in the methanogenesis pathway, but also of a group of proteins annotated as flagellin proteins. In bacteria, the flagellar filaments are composed of polymers of one or more protein subunits referred to as flagellin.3 The genome annotation for M. jannaschii indicates genes encoding three flagellin proteins (FlaB1, FlaB2 2 and FlaB3) in an operon-like arrangement, although the flagellum-like structures on M. jannaschii have been sug4 gested to be more similar to type IV pili (Tfp) than flagella. 5 In a recent paper, Mukhopadhyay et al. reported that two proteins with tryptic peptide masses similar to those predicted by the FlaB2 and FlaB3 open reading frames (ORFs: MJ0892 and MJ0893, respectively) were altered in abundance in response to cell growth under different hydrogen partial pressures. Thus, the expression of multiple flagellin proteins in M. jannaschii is regulated in response to changes in the cellular environment. We have compared the two-dimensional electrophoresis (2DE) patterns of M. jannaschii proteins from cells grown under different hydrogen partial pressures, different concentrations of ammonium and harvested at different stages of growth. From these patterns, we have determined the observed isoelectric points and molecular weights for the multiple protein spots identified as flagellin B1 and B2 and compared them with the predicted isoelectric points and molecular weights from the M. jannaschii ORFs for FlaB1 and FlaB2. Based on a thorough examination of the predicted protein sequences from these ORFs and the tryptic peptide fragments revealed by mass spectrometry analysis of proteins extracted from the 2DE gels, we conclude that posttranslational modifications of the flagellin B1 and B2 proteins occur as part of the cellular response to these different growth conditions producing dramatic structural changes in the final protein products that could affect flagellum assembly and, therefore, cell motility. Materials and methods Cell growth M. jannaschii cells were grown in a 16-L stainless steel fermenter (New Brunswick Scientific, operated by the Fermentation Facility of the University of Illinois School of Life Sciences) under control conditions (defined as growth at 83°C in a minimal mineral salts medium containing 476 mM NaCl, 14 mM MgCl2, 14 mM MgSO4, 22 mM NH4Cl, 4.6 mM KCl, 2 mM Na2S, 0.8 mM KH2PO4, 10 mM NaHCO3, 8.4 µM CoCl2, 3.8 µM FeCl3, 7.3 µM ZnCl2, 5.1 µM MnCl2, 5 mM CaCl2, 4.2 µM NiCl2, 3.1 µM CuSO4, 2 µM Na2MoO4, 2 µM Na2SeO4, 2 µM Na2WO4 and 73.4 µM nitrilotriacetic acid, pH 6.0) pressurized with 100 kPa hydrogen and 25 kPa CO2 and harvested in the exponential phase of growth. To study the effect of growth under reduced hydrogen pressure, the partial pressure of hydrogen was reduced from 100 kPa to 5 kPa with the total gas pressure maintained by supplementing with N2. Cells were harvested 2 hours later, still in exponential growth phase. For comparison of proteins in M. jannaschii cells in exponential and stationary growth phases, cells were grown under control conditions, harvested at different time points and counted with a Petroff–Hauser cell counter. Protein changes related to the concentration of ammonium in the growth media were analyzed by inoculating a fermenter containing control media (except NH4Cl concentration was 0.44 mM instead of 22 mM), allowing the cells to reach exponential growth phase and harvesting an aliquot. The concentration of NH4Cl in the fermenter was increased to 22 mM and an aliquot of cells (still in exponential growth) was collected three hours later. All cells were washed twice with 385 mM NaCl + 28 mM MgCl2 after harvest, collected by centrifugation and rapidly frozen. Sample preparation Frozen M. jannaschii cells were thawed and immediately mixed with five volumes of a solution containing 9 M urea, 2% (v / v) 2-mercaptoethanol, 2% (v / v) ampholytes (Bio-Rad pH 8–10) and 4% (v / v) Nonidet P40 in the presence of protease inhibitors (Boeringer Mannheim Complete Mini protease inhibitor cocktail). The cell lysate was incubated at room temperature for 10 min and then centrifuged at 435,000 g for 10 min in a Beckman TL100 tabletop ultracentrifuge. Protein concentrations of the resulting clarified lysates were determined by using the Ramagli modification of the Bradford protein assay.6 Electrophoresis Isoelectric focusing (IEF) was done using a mixture (50 : 50) of pH 3–10 and pH 5–7 carrier ampholytes (BioRad) in 7-inch tube gels with a diameter of 1.5 mm for 14,000 V–h essentially as described by Anderson and Anderson.7 Aliquots of M. jannaschii whole-cell lysates containing 20 µg of protein (for silver staining) or 300 µg of protein (for Coomassie Blue staining) were loaded onto each IEF gel. After IEF, first-dimension gels were equilibrated in a buffer containing sodium dodecyl sulfate (SDS) as originally described by O’Farrell8 and then loaded onto 10–17% 9 polyacrylamide gradient gels cast as slabs. The seconddimension separation was done using the Laemmli buffer 8,9 system as previously described. Proteins were then fixed and stained in the gels using 0.2% (w / v) Coomassie Blue R250 in 2.5% (v / v) phosphoric acid and 50% (v / v) etha10 nol, or fixed in 50% (v / v) ethanol with 0.1% (v / v) formaldehyde and 1% (v / v) acetic acid for subsequent staining 11 with silver nitrate. Digitization and quantitative analysis of 2DE patterns The 2DE protein patterns were digitized using an Eikonix 1412 CCD scanner interfaced with a VAXstation C.S. Giometti et al., Eur. J. Mass Spectrom. 7, 207–217 (2001) 4000-90. Parameter files, referred to as spot files, were pro12 duced as described previously. A master pattern of the M. jannaschii proteins detected with silver stain was generated by making a copy of a spot file from cells grown under control conditions and harvested in exponential phase. Proteins in all of the spot files representing the 2DE protein patterns from experiments were matched to the master pattern so that each protein was numbered and the integrated density was determined. The software used for image acquisition and data analysis has been previously described.12–14 209 ter (Thermo Finnigan, San Jose, CA, USA). Tandem mass spectra were automatically collected under computer control during the 30 min LC-MS/MS runs. Recorded MS/MS spectra were then subjected directly to SEQUEST database 15 without need for manual interpretation. searches SEQUEST was used to identify proteins in a spot by correlating experimental MS/MS spectra to protein sequences in the M. jannaschii open reading frame database. Results Protein identification by peptide mass spectrometry Capillary liquid chromatography-electrospray tandem mass spectrometry (µ-LC-ESI-MS/MS) was used to identify M. jannaschii proteins. Approximately 300 µg of protein was loaded onto replicate gels. After second-dimension separation, the proteins were detected by staining with Coomassie Blue followed by five cycles of destaining in 20% (v / v) ethanol. Protein spots to be identified were cut from replicate gels and the proteins within 2–5 replicate spots were digested in-gel with trypsin (Promega sequencegrade trypsin, 12.5 ng µg–1). The peptides were eluted from the gel pieces by extracting three times, first with equal parts of 25 mM ammonium bicarbonate and acetonitrile and then twice with equal parts of 5% (v/v) formic acid and acetonitrile. The tryptic digests were loaded onto a 365 µm o.d. × 100 µm i.d. fused-silica capillary column packed with either 10 µm POROS 10 R2 (PE Biosystems) to a length of 10–15 cm or 5 µm Zorbax XDB-C18 packing material (Agilent Technologies) to a length of 7–9 cm. The tryptic peptides were separated by using a 30 min linear gradient of 2–60% solvent (80% acetonitrile / 0.5% acetic acid) for POROS 10R2 and of 0–60% solvent (80% acetonitrile / 0.02% heptafluorobutyric acid) for Zorbax-C18 and were then introduced into an LCQ ion trap mass spectrome- Comparison of proteins from M. jannaschii grown under different conditions Comparison of 2DE patterns of proteins from M. jannaschii grown with control (100 kPa) and with deficient (5 kPa) hydrogen partial pressures revealed numerous quantitative protein changes (Figure 1). Among these changes was the almost complete disappearance of a relatively intense protein spot at molecular weight 30 kDa (master spot number [MSN] 1223) and a triplet of protein spots at molecular weight 27 kDa directly below (MSN 1224, 1225 and 1226) in cells grown with reduced hydrogen. Along with the disappearance of these four proteins, four other proteins (MSN 81, 119, 166 and 307) were observed consistently to appear or increase significantly in abundance (Table 1). In a comparison of M. jannaschii cells grown with control hydrogen partial pressure but harvested in either exponential or stationary phase, proteins MSN 81, 119, 166 and 307 were missing or just barely detectable in patterns from exponential cells, but were significantly expressed in stationary cells [Figures 2(c) and (d)]. Unlike the hydrogendepleted cells [Figure 2(b)], however, the stationary cells contained MSN 1223, 1224, 1225 and 1226 in amounts comparable to exponential cells. Cells harvested in exponential Figure 1. The two-dimensional gel electrophoresis patterns of proteins from M. jannaschii cells grown under control and low hydrogen partial pressure conditions. (a) Control; (b) low hydrogen (see Materials and Methods for details). Arrows indicate proteins present or absent under specific growth conditions. These proteins are shown in detail in Figure 2. 210 Structural Modifications of Methanococcus Jannaschii Flagellin Proteins Table 1. Quantitative differences in M. jannaschii proteins after cell growth with control and deficient hydrogren concentrations. Master spot number, the protein identification number designated defined by matching x- and y-coordinates relative to the M. jannaschii protein master pattern; average integrated density, the average of values from four to five replicated 2DE gels of the same protein sample; low hydrogen, 5 kiloPascals (kPa); control hydrogen, 100 kPa; ND, not detectable; lost, protein was detectable in patterns from control cells but not in patterns from low hydrogen cells; induced, protein was not detectable in control cells but was detectable in low hydrogen cells. The numbers in parentheses are the coefficients of variation (standard deviation divided by the mean times 100) for the average integrated density values. Master spot no. Average integrated density: control hydrogen/low hydrogen Ratio of control/low hydrogen MSN0081 11450 (4%) / 119400 (8%) 0.96 MSN0119 4480 (12%) / 56480 (7%) 0.79 MSN0166 ND / 16680 (4%) induced MSN0307 ND / 17250 (25%) induced MSN1223 114020 (5%) / ND lost MSN1224 7220 (13%) / ND lost MSN1225 92100 (16%) / ND lost MSN1226 18870 (32%) / ND lost phase after growth with low ammonium (0.44 mM) [Figure 2(e)] contained minimal amounts of MSN 81, 119, 166, 307, 1223, 1224, 1225 and 1226. When cells still in exponential growth were harvested 3 hours after the concentration of ammonium was raised to 22 mM [Figure 2 (f)], all of these proteins were detectable. Identification of M. jannaschii proteins The sequences of tryptic peptides from proteins MSN 81, 119, 166, 307, 1223, 1224, 1225 and 1226 were obtained by µLC-MS/MS (Table 2). Using SEQUEST, the M. jannaschii ORFs predicting tryptic peptide sequences matching, with the highest confidence level, those observed for the proteins analyzed were MJ0891 and MJ0892, flagellin B1 and flagellin B2 precursors, respectively. The M. jannaschii flagellin B1 and B2 proteins have a high degree of sequence similarity with the Methanococcus voltae flagellin B1 and B2 sequences, especially at the amino and carboxy terminal ends (Figure 3). The amino termini include a sequence of 12 amino acids that could serve as a leader sequence in the precursor proteins.16, 17 Multiple amino acid sequences that could serve as N-glycosylation 17 sites (for example, Asn-X-Thr/Ser ) are also present in both M. voltae and M. jannaschii flagellin B1 and B2 proteins. M. jannaschii MSN 81 and MSN 1223 contained similar tryptic peptides matching those predicted for flagellin B2, whereas MSN 1224, 1225 and 1226 (1225 and 1226 were analyzed by mass spectrometry as one protein due to their proximity on the gels), 119, 166 and 307 all contained tryptic peptides matching those predicted for flagellin B1 (Figure 4). The peptide of flagellin B1 containing the N- glycosylation motif at residue 113 was detected in MSN 119, but not in MSN 166, 307, 1224, 1225 or 1226. Similarly, the flagellin B2 peptides with glycosylation sites at residues 95 and 171 were detected in tryptic digests of MSN 81, but not in digests of MSN 1223. The observed molecular weights for MSN 81 and MSN 1223 were 24.8 kDa and 30.2 kDa, respectively, whereas the predicted molecular weight for M. jannaschii flagellin B2 precursor (MJ0892) is 22.5 kDa. The isoelectric points of MSN 81 and MSN 1223 were measured as 4.98 and 4.38, respectively, compared with the predicted isoelectric point of 5.4. The triplets of proteins identified as flagellin B1 had observed molecular weights of 27.3, 27.5 and 27.6 kDa (MSN 1224, 1225 and 1226, respectively) or 23.4, 23.6 and 23.4 kDa (MSN 119, 166 and 307, respectively, although the predicted molecular weight of the flagellin B1 precursor is 22.7 kDa. The isoelectric points of the two triplet clusters were 4.31-4.46 (MSN 1224, 1225, 1226) and 4.63–4.73 (MSN 119, 166, 307), slightly less than the predicted isoelectric point of 4.91. Discussion The flagella of most bacteria contain only one type of protein subunit, with a few exceptions, such as Caulobacter crescentus, which expresses two flagellin proteins (flagellins A and B), apparently assembled in tandem.18 In contrast, multiple genes encoding flagellin-like proteins have 2,17,19 been consistently revealed in archaeal genomes. The Halobacterium halobium genome contains five genes encoding five structurally related flagellin proteins, two at one locus (flagellins A1 and A2) and three at a separate locus C.S. Giometti et al., Eur. J. Mass Spectrom. 7, 207–217 (2001) 211 Figure 2. The region of the two-dimensional gel electrophoresis patterns of M. jannaschii proteins from cells grown and harvested under various conditions that shows dramatic differences in specific proteins. (a) Cells grown in 100 kPa hydrogen and harvested in exponential phase [region of pattern in Figure 1(a)]; (b) cells grown in 5 kPa hydrogen and harvested in exponential phase [region of pattern in Figure 1(b)]; (c) cells grown in 100 kPa hydrogen and harvested in exponential phase (different experiment than cells for Figure 1); (d) same as (c), but harvested in stationary phase; (e) cells grown in 0.44 mM ammonium and harvested in exponential phase; (f) cells grown in 22 mM ammonium and harvested in exponential phase. Numbers refer to the master spot numbers for M. jannaschii proteins referred to in Table 1. The difference in the relative abundance of protein 1225 and protein 1226 in (a) compared with (c), both cell preparations harvested in exponential phase during two different experiments, remains to be characterized. This difference could indicate variability in the modification process responsible for producing the isoelectric point difference that is independent of growth conditions. (flagellins B1, B2 and B3). Flagellins B1, B2 and B3 are sulfated glycoproteins with molecular weights of 26, 30 and 36 kDa according to SDS polyacrylamide gel electrophoresis migration patterns,20 although the gene sequences predict molecular weights of approximately 20 kDa. High-resolution, one-dimensional SDS gels revealed a stair-step pattern 21 of protein bands when purified flagella were analyzed. Deglycosylation of the H. halobium flagellin proteins produced proteins migrating as if they were 7 kDa smaller, still 20 inconsistent with their genome sequences. Thus, a protein modification in addition to glycosylation has been suggested for the H. halobium flagellin B proteins. M. voltae has a multigene family encoding four flagellin proteins, all with N termini that have a high degree of simi17,19 larity with the H. halobium flagellins. The conservation of the flagellin amino terminus across the diverse branches of the archaeal domain represented by Halobacterium and Methanococcus has led to the hypothesis that these proteins possess leader peptides,16 hence their annotation in some sequence databases as flagellin precursors. The four M. 212 Structural Modifications of Methanococcus Jannaschii Flagellin Proteins Table 2. Peptides detected by µLC-MS/MS of tryptic digests of M. jannaschii proteins. Master spot number, as described for Table 1; Peptide sequence matched, the peptide best matched by SEQUEST database search; Xcorr, the cross correlation score; Mj ORF, open reading frame in the M. jannaschii sequenced genome; pI, predicted isoelectric point; MW, predicted molecular weight; Protein name, identification based on genome annotation. a,b Master spot no. Peptide sequence matched Xcorr Mj ORF pI MW Protein name MSN 81 K.AINYLAIYITPNAGSAAIDLNQTK.I L.AIYITLPNAGSAAIDLNQTK.I N.ASAVGLNLVPR.T 5.4056 4.7986 MJ0892 5.40 22577 Flagellin B2 2.9426 3.2058 5.4866 4.1721 3.3848 3.4061 5.1703 6.1497 4.0556 MJ0891 4.91 22700 Flagellin B1 3.5357 3.9475 3.2181 4.3844 6.1616 3.6614 MJ0891 4.91 22700 Flagellin B1 MJ0891 4.91 22700 Flagellin B1 K.LAIYITPNAGSAPIDLK.N 3.4110 3.8005 4.0745 R.SEVSGQFQPEFGAPAVIQFTTPAAY.T R.SEVSGQFQPEFGAPAVIQFTTPAAYTQTVIELQ. R.TTPAAYTQTVIELQ. 4.9564 6.6269 3.7849 K.ESTEQVASGLSTLQVIGIHDNK.A K.ILITDGEK.K 3.2328 2.0457 MJ0892 5.40 22577 Flagellin B2 K.ILITDGEKK.A K.STTPVINK.G R.TTVTGSVIPEFGAPAVIEFTTPAAYLSTQEVIQLQ. 2.7042 1.5499 2.1959 K.GDIAVLLVNANAVFNK.A R.SEVSGQFQPEFGAPAVIQFTTPAAY.T 4.6035 5.0167 MJ0891 4.91 22700 Flagellin B1 R.SEVSGQFQPEFGAPAVIQFTTPAAYTQTVIELQ. 4.0840 K.ESTEQVASGLSTLQVIGIHDNK.A G.FLQQKAMATGKESTEQVASGLSTLQVIGIHDNK.A K.GDIVALTINASAVGLNLVPR.T K.ILITDGEKKAVLR.Y L.STLQVIGIHDNK.A K.STTPVINKGDIVALTINASAVGLNLVPR.T L.TINASAVGLNLVPR.T R.TTVTGSVIPEFGAPAVIEFTTPAAY.L R.TTVTGSVIPEFGAPAVIEFTTPAAYLSTQEVIQLQ MSN 119 # K.ESTEQVASGLM CIGVTGHYDK.T # K.ESTEQVASGKM CIGVTGHYDK.T K.GDIAVLLVNANAVFNKAIPTR.S K.LAIYITPNAGSAPIDLK.N K.LFLIYDGESHVLN.Y K.LFLIYDGESHVLNYSTVTTA.T R.SEVSGQFQPEFGAPAVIQFTTPAAY.T R.SEVSGQFQPEFGAPAVIQFTTPAAYTQTVIELQ. R.TTPAAYTQTVIELQ. MSN 166 # K.ESTEQVASGLM C*IGVTGHYDK.T # K.ESTEQVASGKM CIGVTGHYDK.T R.SEVSGQFQPEFGAPAVIQF.T R.SEVSGQFQPEFGAPAVIQFTTPAAY.T R.SEVSGQFQPEFGAPAVIQFTTPAAYTQTVIELQ. R.TTPAAYTQTVIELQ. MSN 307 # K.ESTEQVASGLM CIGVTGHYDK.T # K.ESTEQVASGKM CIGVTGHYDK.T MSN 1223 MSN 1224 3.3900 4.2388 3.3634 4.5540 3.3351 3.4069 5.5184 3.6628 3.7208 4.9032 C.S. Giometti et al., Eur. J. Mass Spectrom. 7, 207–217 (2001) 213 Table 2. Peptides detected by µLC-MS/MS of tryptic digests of M. jannaschii proteins. Master spot number, as described for Table 1; Peptide sequence matched, the peptide best matched by SEQUEST database search; Xcorr, the cross correlation score; Mj ORF, open reading frame in the M. jannaschii sequenced genome; pI, predicted isoelectric point; MW, predicted molecular weight; Protein name, identification based on genome annotation (continued). a Master spot no. Peptide sequence matched MSN 1225 and 1226 a,b Xcorr Mj ORF pI MW Protein name K.GDIAVLLVNANAVFNK.A K.GDIAVLLVNANAVFNKAIPTR.S 3.5855 2.6567 MJ0891 4.91 22700 Flagellin B1 R.SEVSGQFQPEFGAPAVIQF.T R.SEVSGQFQPEFGAPAVIQFTTPAAY.T R.SEVSGQFQPEFGAPAVIQFTTPAAYTQTVIELQ. 5.4398 4.6284 4.0281 # M , oxidized methionine; during SEQUEST database searches, these peptides were matched using the assumption of a mass shift of 16 on each methionine residue due to oxidation occurring during sample preparation and processing. b * C , iodoacetamide-modified cysteines; during SEQUEST database searches, these peptides were matched using the assumption of a mass shift of 57 on each cysteine residue due to alkylation by iodoacetamide. voltae flagellin genes encode flagellin A and flagellin B1, B2 and B3, homologous to the H. halobium flagellin A1, A2, B1, B2 and B3 genes, respectively. Of the four types of flagellins, FlaB1 and FlaB2 are the major flagellin proteins expressed in M. voltae.21 As in H. halobium, the genes encoding the M. voltae flagellins B1 and B2 predict proteins with molecular weights of 22.4 kDa and 22.8 kDa, respectively, which is considerably smaller than the 33 kDa and 31 kDa molecular weights observed on SDS gels for purified 22 flagellar filaments from M. voltae. All of the M. voltae flagellin proteins contain internal glycosylation signals (Asn-X-Thr/Ser) (at positions 38, 71, 77, 115 and 136 in flagellin B1 and positions 38, 72, 77, 113, 172 and 208 in flagellin B2) analogous to those in H. halobium, although there is no evidence that the M. voltae flagellins are actually glycosylated.19 As in H. halobium, removal of glycosyl Figure 3. Protein sequence alignments of flagellins B1 and B2 from M. jannaschii and M. voltae. MJ0891, amino acid sequence predicted for M. jannaschii flagellin B1; FLA1_METVO, amino acid sequence predicted for M. voltae flagellin B1; MJ0892, amino acid sequence predicted for M. jannaschii flagellin B2; FLA2_METVO, amino acid sequence predicted for M. voltae flagellin B2. The box indicates the 12 amino-terminal amino acids thought to represent a leader sequence in the precursor form of the archaeal flagellin B proteins. The putative glycosylation sites (Asn-X-Thr/Ser) are underlined in each sequence. Dashes are used to provide optimal alignment of the M. voltae and M. jannaschii sequences. 214 Structural Modifications of Methanococcus Jannaschii Flagellin Proteins Figure 4. Protein sequence alignments of M. jannaschii flagellins B1 and B2 based on open reading frames MJ0891 and MJ0892 with the putative sequences of MSN 81, 119, 166, 307, 1223, 1224, 1225 and 1226. The peptides corresponding to the peptide masses observed for each protein (Table 2) are shown in bold italicized type. The box indicates the 12 amino-terminal amino acids thought to represent a leader sequence in the precursor form of the archaeal flagellin B proteins. The putative glycosylation sites (Asn-X-Thr/Ser) are underlined in each sequence. Numbers indicate the amino acid residue location within the sequence. groups, if they were present, would be insufficient to explain the size discrepancy between the predicted and observed SDS molecular weights for the M. voltae flagellin B1 and B2 proteins, suggesting that other protein modifications contribute to the molecular weights of these molecules. The M. jannaschii genome encodes three flagellin proteins (FlaB1, B2 and B3) with a significant overall similarity to the respective M. voltae flagellins and with amino terminal sequence homology to the H. halobium flagellins.2,17,19 Our 2DE analysis of the M. jannaschii proteome has C.S. Giometti et al., Eur. J. Mass Spectrom. 7, 207–217 (2001) revealed that M. jannaschii cells can express multiple forms of both flagellin B1 and B2 proteins, depending, in a seemingly complex way, on cellular growth conditions. The flagellin B2 proteins (seen in 2DE patterns as MSN 81 or 1223) appear as relatively abundant, well-resolved protein spots differing in molecular weight by 5 kDa and in isoelectric point by 0.6. In the presence of control levels of hydrogen, exponentially growing cells express the higher molecular weight form (MSN 1223) in approximately 10fold more abundance than they express the lower molecular weight and more alkaline form (MSN 81) [Figures 2(a) and (c)]. Cells growing exponentially in 20-fold less hydrogen, in contrast, had no detectable MSN 1223 and 10-fold more MSN 81 relative to the control cells. The M. jannaschii proteins identified as flagellin B1, based on their tryptic peptide masses, varied in abundance in concert with the changes observed in the flagellin B2 proteins. Resolved as a triplet of proteins with slightly different isoelectric points, the higher molecular weight flagellin B1 proteins (MSN 1224, 1225 and 1226) in the control cells were abundant whereas the lower proteins were barely detectable (MSN 119) or undetectable (MSN 166 and MSN 307). The reverse was true in cells grown with a decreased hydrogen partial pressure; the lower molecular weight flagellin B1 proteins were abundant whereas the higher molecular weight proteins were undetectable. Mukhopadhyay and co-workers observed the appearance and disappearance of two M. jannaschii proteins identified as B-type flagellins in response to cell growth at different hydrogen partial pressures.5 These proteins were of the same apparent molecular weights as MSN 1223, 1224, 1225 and 1226 in our 2DE patterns and they were expressed most strongly under the high-hydrogen growth condition, as observed in our experiments. The separation of the proteins in their report was insufficient to resolve the charge heterogeneity seen in the 2DE patterns reported here and the background staining precluded the observation of the lower 5 molecular weight forms of flagellins B1 and B2. M. jannaschii cells harvested in stationary phase [Figure 2 (d)] and in exponential phase after a shift from limited to control levels of ammonium [Figure 2 (f)] showed expression of approximately equal amounts of all forms of flagellins B1 and B2, indicating either that expression of the high- or low-molecular weight forms is not mutually exclusive within the cells or that a mixed population of cells was harvested in the latter experiments. A third group of triplet protein spots, as yet unidentified but similar in configuration to MSN 119, 166 and 307 as well as MSN 1224, 1225 and 1226, appeared approximately halfway between these two sets of triplets in cells from both the stationary and ammonium-enriched cultures. This triplet could represent an additional form of the flagellin B1 protein having a molecular mass intermediate between that observed for proteins MSN 1224, MSN 1225 and MSN 1226 and that seen for proteins MSN 119, MSN 166 and MSN 307. After growth on limited ammonium, M. jannaschii cells were observed to express only minimal amounts of flagellin B1 or B2 proteins [Figure 215 2(e)], suggesting that flagellin synthesis can be essentially shut down under specific growth conditions. The flagellin B1 proteins represented by MSN 1224, MSN 1225 and MSN 1226 and the flagellin B2 proteins represented by MSN 1223 have apparent molecular weights of approximately 27 and 30 kDa, respectively, in the presence of SDS, although the predicted molecular weights for both proteins are approximately 21 kDa. This size discrepancy is almost identical to that reported for both H. halobium and M. voltae19,20,22 and cannot be accounted for by the inclusion of the leader sequence of only 1.4 kDa. Actually, no tryptic peptides with masses similar to those predicted for the leader sequence were found for any of the M. jannaschii proteins analyzed, suggesting that the expressed proteins observed in 2DE patterns lack the precursor leader sequence. Flagellin proteins, due to their association with the cell membrane as part of the flagellar structure, have hydrophobic domains that may bind SDS inefficiently, thus altering their migration position in the electrophoresis pattern. Alternatively, as yet undiscovered post-translational modifications, specific to the archaeal flagellin B1 and B2 structures, may cause the higher molecular weight migration of these proteins, since similar discrepancies between the SDS molecular weights and predicted molecular weights have been reported for H. halobium20 and M. voltae19,23 and, now, for M. jannaschii. Like the flagellin B1 and B2 sequences of H. halobium and M. voltae, the predicted protein sequence for M. jannaschii flagellins B1 and B2 includes glycosylation signals (Asn-X-Thr/Ser). Whereas M. voltae has five glycosylation sites in the flagellin B1 sequence and six in the flagellin B2 sequence, M. jannaschii has only three signals in the flagellin B1 sequence (at residues 38, 113 and 129) and five in the flagellin B2 sequence (at residues 38, 95, 128, 135 and 171). It is notable that the glycosylation site at residue 38 appears in both flagellin B1and B2 in both M. voltae and M. jannaschii, whereas the remainder of the potential glycosylation sites appear to be species- and flagellin-specific. Similar to M. voltae19 and in contrast to H. halobium,24 there is no direct evidence for glycosylation of the M. jannaschii flagellin B1 and B2 proteins. The lack of charge heterogeneity for flagellin B2 (MSN 81 and 1223), with five possible glycosylation sites, suggests there are no post-translational modifications of this protein (such as the glycosylation with sulfated saccharides observed for all H. halobium flagellin proteins24) that would affect the isoelectric point. The triplets of flagellin B1 (MSN 1224, 1225 and 1226 and MSN 119, 166 and 307), however, do suggest a post-translational modification that causes isoelectric point heterogeneity and subtle differences in molecular weight. The tryptic digests from MSN 119 and MSN 81 contained peptides with the N-glycosylation motifs at residues 113 and 95 and 171, respectively, whereas the remainder of the proteins analyzed did not. This observation is consistent with these two proteins being the least modified forms, i.e. having the most unmodified peptides, in the groups of 216 Structural Modifications of Methanococcus Jannaschii Flagellin Proteins flagellin B1 and B2 proteins separated by 2DE. The more acidic, higher molecular weight proteins could be expected, conversely, to have more modified peptides, which would not match the predicted peptide masses. Further study will be required to confirm whether the observed charge and molecular weight heterogeneity is due to sulfated glycoproteins such as those found in H. halobium22 or to some other type of modification such as deamidation or phosphorylation. The molecular weight and isoelectric point differences between the two populations of flagellin B1 and B2 proteins suggest (a) varying degrees of protein–protein association (for example, flagellin protein homodimers that remain together under the denaturation conditions used for sample preparation) that vary with cell growth conditions, (b) the occurrence of a proteolytic event that results in the removal of a peptide sequence from each of these proteins, or (c) the synthesis of proteins lacking a portion of the predicted protein sequence under specific growth conditions. The same sample preparation method has been used for all experiments described, suggesting that the dissociation efficiency of possible flagellin complexes should be consistent. Thus, if the difference in molecular weight of the flagellins observed is related to the dissociation of protein complexes, that dissociation must be a cellular event. The observed molecular weights do not correlate with any obvious combination of flagellin B1 or flagellin B2 homocomplexes, however. A proteolytic event, i.e. a post-translational modification, is expected to cause the loss of a series of amino acids from the amino or carboxy terminal end of the flagellin proteins which would total masses of approximately 4 kDa and 5 kDa for flagellin B1 and B2, respectively, based on the positions of the respective proteins in the 2DE patterns. The complete amino acid sequences of flagellins B1 and B2 were not covered by the mass spectrometry analyses done here, so proteolysis cannot be completely ruled out as a reason for the appearance of flagellin proteins with different molecular weights. However, tryptic peptides with masses comparable to those expected from the carboxy termini of both proteins were found in preparations from all of the proteins identified as flagellin B1 and B2, both high and low molecular weight. Thus, no carboxy terminal peptides were consistently missing from any of the proteins studied. No tryptic peptides with masses consistent with the predicted amino terminal sequences of the flagellin B1 and B2 proteins were found in any of the preparations analyzed, either the high- or the lowmolecular-weight forms. Thus, no differences indicative of proteolysis from the amino terminal end of the proteins were observed either. Therefore, our observations thus far suggest that M. jannaschii cells possess a regulatory mechanism that directs the synthesis of multiple forms of the flagellin B1 and B2 proteins having different molecular weights under different growth conditions. The observation of differential expression of multiple forms of proteins identified as the flagellin B1 and B2 proteins in M. jannaschii suggests a regulatory mechanism in the Archaea for the assembly and function of flagella. Further characterization of the structural differences between these multiple forms of flagellins B1 and B2 will require additional investigations into the chemical composition of the post-translational modifications resulting in the charge heterogeneity of flagellin B1 but not flagellin B2 and into the amino acid composition of the different molecular weight variants of the two proteins. Such investigations will provide critical insight into the regulation of cell motility in this poorly understood branch of life. Acknowledgments The authors thank Eric F. Johnson for his expert assistance with the growth of M. jannaschii in the University of Illinois Fermentation Facility. The research described in this paper was supported by the Microbial Genome Program in the Office of Biological and Environmental Research, United States Department of Energy, under contract No. W31-109-ENG-38. References 1. W. Jones, J.A. Leigh, F. Mayer, C.R. Woese and R.S. Wolfe, Arch. Microbiol. 136, 254 (1983). 2. C.J. Bult, O. White, G.J. Olsen, L. Zhou, R.D. Fleischmann, G.G. Sutton, J.A. Blake, L.M. Fitzgerald, R.A. Clayton, J.D. Gocayne, A.R. Kerlavage, B.A. Dougherty, J.-F. Tomb, M.D. Adams, C.I. Reich, R. Overbeek, E.F. Kirkness, K.G. Weinstock, J.M. Merrick, A. Glodek, J.L. Scott, N.S.M. Geoghagen, J.F. Wiedman, J.L. Fuhrmann, D. Nguyen, T.R. Utterback, J.M. Kelley, J.D. Peterson, P.W. Sadow, M.C. Hanna, M.D. Cotton, K.M. Roberts, M.A. Hurst, B.P. Kaine, M. Borodovsky, H.-P. Klenk, C.M. Fraser, H.O. Smith, C.R. Woese and J.C. Venter, Science 273, 1058 (1996). 3. S. Koyasu, M. Asada, A. Fukuda and Y. Okada, J. Mol. Biol. 153, 471 (1981). 4. D.P. Bayley and K.F. Jarrell, J. Mol. Evol. 46, 370 (1998). 5. B. Mukhopadhyay, E.F. Johnson and R.S. Wolfe, Proc. Natl. Acad. Sci. USA 97, 11522 (2000). 6. L.S. Ramagli and L.V. Rodriguez, Electrophoresis 6, 559 (1985). 7. N.G. Anderson and N.L. Anderson, Anal. Biochem. 85, 331 (1978). 8. P.H. O’Farrell, J. Biol. Chem. 250, 4007 (1975). 9. N.L. Anderson and N.G. Anderson, Anal. Biochem. 85, 341 (1978). 10. N.L. Anderson, S.L. Nance, S.L. Tollaksen, F.A. Giere and N.A. Anderson, Electrophoresis 6, 592 (1985). 11. C.S. Giometti, M.A. Gemmell, S.L. Tollaksen and J. Taylor, Electrophoresis 12, 536 (1991). C.S. Giometti et al., Eur. J. Mass Spectrom. 7, 207–217 (2001) 12. N.L. Anderson, J. Taylor, A.E. Scandora, B.P. Coulter and N.G. Anderson, Clin. Chem. 27, 1807 (1982). 13. C.S. Giometti and J. Taylor, in Advances in Electrophoresis, Ed by M.J. Dunn. Walter de Gruyter and Co., New York, USA, pp. 359–389 (1991). 14. C.S. Giometti, J. Taylor, M.A. Gemmell, S.L. Tollaksen, N.D. Lalwani and J.K. Reddy, Appl. Theoret. Electrophoresis 2, 101 (1991). 15. J.K. Eng, A.L. McCormack and J.R. Yates III, J. Am. Soc. Mass Spectrom. 5, 976 (1994). 16. M.L. Kalmokoff, T.M. Karnauchow and K.F. Jarrell, Biochem. Biophys. Res. Comm. 167, 154 (1990). 17. M.L. Kalmokoff and K.F. Jarrell, J. Bacteriol. 173, 7113 (1991). 18. A. Fukuda, M. Asada, S. Koyasu, H. Yoshida, K. Yaginuma and Y. Okada, J. Bacteriol. 145, 559 (1981). 217 19. M.L. Kalmokoff, K.F. Jarrell and S.F. Koval, J. Bacteriol. 170, 1752 (1988). 20. L. Gerl and M. Sumper, J. Biol. Chem. 260, 13246 (1988). 21. K.F. Jarrell, D.P. Bailey, V. Florian and A. Klein, Mol. Microbiol. 20, 657 (1996). 22. M. Alam and D.J. Oesterhelt, Mol. Biol. 176, 459 (1984). 23. M.L. Kalmokoff, K.F. Jarrell and S.F. Koval, J. Bacteriol. 170, 1752 (1988). 24. F. Weiland, G. Paul and M. Sumper, J. Biol. Chem. 260, 15180 (1985). Received: 1 February 2001 Revised: 30 March 2001 Accepted: 23 May 2001 Web Publication: 12 July 2001