* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Download BlastLecture8
Human genome wikipedia , lookup
Genomic library wikipedia , lookup
Gel electrophoresis of nucleic acids wikipedia , lookup
Vectors in gene therapy wikipedia , lookup
DNA profiling wikipedia , lookup
Nucleic acid analogue wikipedia , lookup
Epigenomics wikipedia , lookup
Cell-free fetal DNA wikipedia , lookup
Bisulfite sequencing wikipedia , lookup
No-SCAR (Scarless Cas9 Assisted Recombineering) Genome Editing wikipedia , lookup
History of genetic engineering wikipedia , lookup
DNA barcoding wikipedia , lookup
Molecular cloning wikipedia , lookup
DNA supercoil wikipedia , lookup
Nucleic acid double helix wikipedia , lookup
Genealogical DNA test wikipedia , lookup
Metagenomics wikipedia , lookup
Extrachromosomal DNA wikipedia , lookup
DNA vaccination wikipedia , lookup
Non-coding DNA wikipedia , lookup
Cre-Lox recombination wikipedia , lookup
Genome editing wikipedia , lookup
Microsatellite wikipedia , lookup
Deoxyribozyme wikipedia , lookup
Point mutation wikipedia , lookup
Therapeutic gene modulation wikipedia , lookup
Artificial gene synthesis wikipedia , lookup
Helitron (biology) wikipedia , lookup
Smith–Waterman algorithm wikipedia , lookup
Day 8 Carlow Bioinformatics Database homology searching November 2006 Why search a Database • To find homologous sequences to your unknown to determine function • To find other related sequences to do evolutionary studies (trees) or to make specialised database (nematode 16sRNA) • To find the mouse or E.coli homolog of your gene of interest • To find genes in a newly sequenced genome • To predict 3-D structure (blast vs PDB) BLAST • For many molecular biologists • a Blast search – with a DNA sequence – at NCBI – accepting default parameters • IS bioinformatics – 70% of searches at NCBI at blastN BLAST • Basic local alignment search tool • More or less unchanged for 15 years • Extraordinarily quick: – Submit seq via satellite to Bethesda MD – Crunch thro 100 GB of sequence – Return results via satellite – ALL in 30 seconds • Available at other sites (EBI, ExPaSy etc.) • with better response times, fewer conditions Reliable servers • http://www.ch.embnet.org/software/bBLAST.html • http://www.ch.embnet.org/software/aBLAST.html – Basic and advanced SwissBlast • http://www.ebi.ac.uk/blast2/index.html – EBI (Cambridge, UK) NCBI Blast • http://www.ncbi.nlm.nih.gov/blast/ – Not the only Blast server! BLAST varieties • blastn: searches a DNA sequence against a DNA database like EMBL, Genbank, or dbEST. also megablast for exact matches • blastp: searches a protein sequence against a protein database such as UniProt, or "nr" a non-redundant database which ideally contains one copy of every available sequence. Then you have: • blastx: searches a DNA sequence (translated in all six reading frames) against a protein database. • tblastn: searches a protein sequence against a DNA database (translated in all six reading frames) – essential for searching EST databases. and in the interests of completeness there is: • tblastx: searches a DNA sequence (translated in all six reading frames) against a DNA database (translated in all six reading frames). finally • Psi-blast an iterative process using position specific subst matrix PSSM to find distantly related sequences Algorithm • Five steps – Break the query seq into short “words” – typically 3 consecutive residues for protein – Search the database for (nearly) exact matches to these words – Extend match “hits” out on either side until score stops going up – these are HSPs (high scoring segment pairs) – Sort the HSPs by some “optimum” criterion – Significant hits are then formally scored, aligned and displayed Alternatives to BLAST • FASTA – A little slower than Blast – More sensitive (so recommended) for DNA to DNA searches • Smith-Waterman (Blitz) – Much slower than Blast (20x slower) – Much more sensitive • But Blast is standard because it gives a “good enough” answer quickly. Blast Blast at NCBI Paste your query sequence here Parallel search in Conserved domain DB Input sequence parameters Optional parameters to change include • Parameters that alter the hits found – – – – – Database searched Word size Substitution matrix Gap penalties Low complexity masking • Parameters that alter the results delivered – – – – Expectation cut-off Limit by organism or taxonomic group Number of hits reported Number of alignments shown Database • If query is a coding gene: translate and search protein database • Search PDB if you want a 3-D structure • Search NR if you want any hit • Search UniProt if you want to know what the hits are • Search dbEST if you want to know if your sequence is expressed • UniProt90: no seq is more than 90% ident to any other (for an uncluttered tree) also UniProt50 Word size • Default at NCBI Blast – 11 for DNA; option of 7 and 5 – 3 for protein; option of 2 • Increasing wordsize will speed search … but will lose sensitivity – It will miss some useful but distant hits • Decreasing wordsize will be more sensitive … but take longer Substitution matrix • By default BLAST uses BLOSUM62 • Can change this – Blosum90 mirrors changes in closely related sequences – Blosum30 changes in distant sequences • Should run 3 blast searches with different substitution matrices. Changes 30-62-90 not linear Substitution matrices Top left part of a BLOSUM 90 matrix A R N D C Q E G H A 5 -2 -2 -3 -1 -1 -1 0 -2 R -2 6 -1 -3 -5 1 -1 -3 0 N -2 -1 7 1 -4 0 -1 -1 0 D -3 -3 1 7 -5 -1 1 -2 -2 C -1 -5 -4 -5 9 -4 -6 -4 -5 Q -1 1 0 -1 -4 7 2 -3 1 E -1 -1 -1 1 -6 2 6 -3 -1 G 0 -3 -1 -2 -4 -3 -3 6 -3 H -2 0 0 -2 -5 1 -1 -3 8 I -2 -4 -4 -5 -2 -4 -4 -5 -4 L -2 -3 -4 -5 -2 -3 -4 -5 -4 I -2 -4 -4 -5 -2 -4 -4 -5 -4 5 1 L -2 -3 -4 -5 -2 -3 -4 -5 -4 1 5 Positive offdiagonals are similar Reality of matrix change • Query: • • Sbjct: GHDEICI GH + C GHACNCG – Scores 39 with Blosum30 5 with Blosum90 • Query: • • Sbjct: HEQCRLEN +E LEN QENAHLEN – Scores 19 with Blosum30 24 with Blosum90 • So GHDEICIHEQCRLEN will find different hits Matrix families • PAM – point accepted mutation – Margaret Dayhoff 1970s (before Genbank) • BLOSUM – based on aligned blocks – Henikoff and Henikoff 1992 – Blosum 62 default (based on aligned seqs 62% identical – don’t ask why 62: it works) • Low PAM = High Blosum – PAM 250 == Blosum 30 – PAM 30 == Blosum 90 Gap penalty • Original Blast was gap-free – Because gapped aligns much more CPU • Now can insert “affine” gaps – Gap open 10; gap extend 1 • Raise gap penalty to discourage gaps – Preferentially gets closely related hits • Lower gap penalty for sensitive search for distant relatives Low Complexity Masking • Seg masks low-complexity regions – “too many” serines, prolines etc. • What a masked sequence looks like: >P04729 Wheat gamma gliadin MKTFLVFALIAVVATSAIAQMETSCISGLERPWQQQPLPPQQSFSQQPPFSQQQQQPLPQ QPSFSQQQPPFSQQQPILSQQPPFSQQQQPVLPQQSPFSQQQQLVLPPQQQQQQLVQQQI PIVQPSVLQQLNPCKVFLQQQCSPVAMPQRLARSQMWQQSSCHVMQQQCCQQLQQIPEQS RYEAIRAIIYSIILQEQQQGFVQPQQQQPQQSGQGVSQSQQQSQQQLGQCSFQQPQQQLG QQPQQQQQQQVLQGTFLQPHQIAHLEAVTSIALRTLPTMCSVNVPLYSATTSVPFGVGTG VGAY* and after low complexity masking: >P04729 SEG low-complexity masked MKTFLVFALIAVVATSAIAQMETSCISGLERPWXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXLNPCKVFLQQQCSPVAMPQRLARSQMWXXXXXXXXXXXXXXXXXXXXXXX RYEAIRAIIYSIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXXXXXXXHQIAHLEAVTSIALRTLPTMCSVNVPLYSATTSVPFGVGTG VGAY* • Xnu masks repeats (from database of common repeats) Masking • Check if masking on/off by default (differs at sites) • Run 2 searches with masking on, masking off ANNYway • Masking by hand: – If you know about the DNA binding domain already • Which is really common and will occupy the top 100 hits against any database – Replace the region with Xs – Re-run blast to find other motifs/domains/information – NCBI blast allows select subsequences • DUST masks low info DNA sequences – Like polyA tails Advanced Expectation cut-off • E value – Expected number of chance hits • Given the database searched • Query HSP length • Related to probability • Default is 10. Expect to find 10 hits as good as this by chance alone • E values less than 10-4 unreliable • So different from p < 0.05 • For short seqs crank E up to 100 or 1000 Data deluge – hits delivered • Default suits general purpose • V = 50 num of “hits” one line descriptions • B = 50 num of alignments between query and hit which are displayed Swiss Blast EBI blast Limit by taxon/organism Database choice NR for getting aNNy hit swissprot or refseq for getting hits that have annotation Month for recent hits The output • Is in five parts 1. Admin – date, size of database, id of query 2. Graphic display of query and hits 3. List of hits with links to database and to… 4. …alignments (may be > 1 HSP per hit) 5. More admin, including errors/warnings Notes! • Record the top admin stuff. Your search will be different – – – – Next week On a different server With different DB With different input parameters • Mouse-over any graphic display – Shows domain structure – Shows if hit is global or local • Read the bottom admin stuff Blast output sp|P06471|HOR3_HORVU B3-HORDEIN Length = 264 Score = 62.5 bits (149), Expect = 1e-09 Identities = 32/63 (50%), Positives = 38/63 (59%) Query: 131 LNPCARSQMWXXXXXXXXXXXXXXXXXXXXXXXRYEAIY LNPCARSQM R+EA+Y Sbjct: 111 LNPCARSQMLQQSSCHVLQQQCCQQLPQIPEQLRHEAVY Query: 191 SII 193 Low-complexity masked region SI+ What sort of residues masked in Sbjct: 171 SIV 173 The query sequence?? May be more HSPs for same hit If big deletion in either seq General blast protocol 1. 2. 3. 4. 5. Find server, choose DB, paste seq, GO Rerun search with/out masking Rerun search with two diff subs matrix 2 x 3 for six searches If top N hits all same family/domain then XXX this region and resubmit 6. LOOK at the results; esp strange ones 7. Limit results by organism Blast notes • Twilight zone <25% protein <70% NA • Because two sequences give high blast scores to a third, doesn’t mean they are related – NNNNDOMAINANNNNDOMAINBNNN – NNNNDAMIANANNNNNNNNNNNNNN – NNNNNNNNNNNNNNNDIMIAMBNNN • E-value vs % ID. >10-4 unreliable • Bit score <50 unreliable