* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
Download Molecular & Genetic Epidemiology
Genome (book) wikipedia , lookup
Genetic engineering wikipedia , lookup
Nutriepigenomics wikipedia , lookup
No-SCAR (Scarless Cas9 Assisted Recombineering) Genome Editing wikipedia , lookup
DNA vaccination wikipedia , lookup
Vectors in gene therapy wikipedia , lookup
Human genome wikipedia , lookup
Epigenetics of neurodegenerative diseases wikipedia , lookup
United Kingdom National DNA Database wikipedia , lookup
DNA barcoding wikipedia , lookup
Pathogenomics wikipedia , lookup
History of genetic engineering wikipedia , lookup
Protein moonlighting wikipedia , lookup
Non-coding DNA wikipedia , lookup
Gene expression profiling wikipedia , lookup
Gene nomenclature wikipedia , lookup
Site-specific recombinase technology wikipedia , lookup
Designer baby wikipedia , lookup
Genome evolution wikipedia , lookup
Microevolution wikipedia , lookup
Point mutation wikipedia , lookup
Genome editing wikipedia , lookup
Metagenomics wikipedia , lookup
Therapeutic gene modulation wikipedia , lookup
Biological Databases Biologists Collect Lots of Data • Hundreds of thousands of species • Millions of articles in scientific journals • Genetic information: – gene names – phenotype of mutants – location of genes/mutations on chromosmes – linkage (distances between genes) • High Throughput technology – Rapid inexpensive DNA sequencing – Many methods of collecting genotype data • Assays for specific polymorphisms • Genome-wide SNP chips • Must have data quality assessment prior to analysis What is a Database? • Organized data • Information is stored in "records" and "fields" • Fields are categories – Must contain contain data of the same type • Records contain data that is related to one object A Spreadsheet can be a Database • columns are Fields • Rows are Records • Can search for a term within just one field • Or combine searches across several fields SNP ID SNPSeq ID Gene +primer -primer Hap A Hap B Hap C D1Mit160_1 10.MMHAP6 7FLD1.seq lymphocyte antigen 84 AAGGTAAAA GGCAATCAG CACAGCC TCAACCTGG AGTCAGAGG CT C — A M-05554_1 12.MMHAP3 1FLD3.seq procollagen, type III, alpha TGCGCAGAA GCTGAAGTC TA TTTTGAGGT GTTAATGGTT CT C — A M-05554_2 X60184 complement component factor i ACTTCCAGC CCTGGCTCT ATATGCCAC CAAGAAGCA A C — M-09947_3 AF067835 caspase 8 TCACAGAGG GAAACATGA AG CTCCACATT GAACCAAAG CA G C T M-11415_1 U02023 insulin-like growth factor binding protein GGGAAAAGC CTGAAAGAA GC AGCTGAAAC CGGACATCA AT T G — D1Mit284_ 3 J05234 nucleolin TGTTGGAAC CGACTTCTT CA AAGAGTCAA AGAATTTATG GAATGA G T T Structured Data • Repository of information • managed and accessed differently • Flat-file (text) • Relational (key) • “talk” to each other Standard Data Formats • DNA sequence = ACGT, but what about gaps, unknown letters, etc. – How many letters per line ??? – ?? Spaces, numbers, headers, etc. – Store as a string, code as binary numbers, etc. • Use a completely different format for proteins? Need standard formats!! FASTA Format • William Pearson (1985) • The FASTA format is now universal for all databases and software that handles DNA and protein sequences One header line, starts with > with a [return] at end All other characters are part of sequence. >URO1 uro1.seq Length: 2018 November 9, 2000 11:50 Type: N Check: 3854 CGCAGAAAGAGGAGGCGCTTGCCTTCAGCTTGTGGGAAATCCCGAAGATGGCCAAAGACA ACTCAACTGTTCGTTGCTTCCAGGGCCTGCTGATTTTTGGAAATGTGATTATTGGTTGTT GCGGCATTGCCCTGACTGCGGAGTGCATCTTCTTTGTATCTGACCAACACAGCCTCTACC CACTGCTTGAAGCCACCGACAACGATGACATCTATGGGGCTGCCTGGATCGGCATATTTG TGGGCATCTGCCTCTTCTGCCTGTCTGTTCTAGGCATTGTAGGCATCATGAAGTCCAGCA GGAAAATTCTTCTGGCGTATTTCATTCTGATGTTTATAGTATATGCCTTTGAAGTGGCAT CTTGTATCACAGCAGCAACACAACAAGACTTTTTCACACCCAACCTCTTCCTGAAGCAGA TGCTAGAGAGGTACCAAAACAACAGCCCTCCAAACAATGATGACCAGTGGAAAAACAATG .. Multi-Sequence FASTA file >FBpp0074027 type=protein; loc=X:complement(16159413..16159860,16160061..16160497); ID=FBpp0074027; name=CG12507-PA; parent=FBgn0030729,FBtr0074248; dbxref=FlyBase:FBpp0074027,FlyBase_Annotation_IDs:CG12507 PA,GB_protein:AAF48569.1,GB_protein:AAF48569; MD5=123b97d79d04a06c66e12fa665e6d801; release=r5.1; species=Dmel; length=294; MRCLMPLLLANCIAANPSFEDPDRSLDMEAKDSSVVDTMGMGMGVLDPTQ PKQMNYQKPPLGYKDYDYYLGSRRMADPYGADNDLSASSAIKIHGEGNLA SLNRPVSGVAHKPLPWYGDYSGKLLASAPPMYPSRSYDPYIRRYDRYDEQ YHRNYPQYFEDMYMHRQRFDPYDSYSPRIPQYPEPYVMYPDRYPDAPPLR DYPKLRRGYIGEPMAPIDSYSSSKYVSSKQSDLSFPVRNERIVYYAHLPE IVRTPYDSGSPEDRNSAPYKLNKKKIKNIQRPLANNSTTYKMTL >FBpp0082232 type=protein; loc=3R:complement(9207109..9207225,9207285..9207431); ID=FBpp0082232; name=mRpS21-PA; parent=FBgn0044511,FBtr0082764; dbxref=FlyBase:FBpp0082232,FlyBase_Annotation_IDs:CG32854-PA,GB_protein:AAN13563.1,GB_protein:AAN13563; MD5=dcf91821f75ffab320491d124a0d816c; release=r5.1; species=Dmel; length=87; MRHVQFLARTVLVQNNNVEEACRLLNRVLGKEELLDQFRRTRFYEKPYQV RRRINFEKCKAIYNEDMNRKIQFVLRKNRAEPFPGCS >FBpp0091159 type=protein; loc=2R:complement(2511337..2511531,2511594..2511767,2511824..2511979,2512032..2512082); ID=FBpp0091159; name=CG33919-PA; parent=FBgn0053919,FBtr0091923; dbxref=FlyBase:FBpp0091159,FlyBase_Annotation_IDs:CG33919PA,GB_protein:AAZ52801.1,GB_protein:AAZ52801; MD5=c91d880b654cd612d7292676f95038c5; release=r5.1; species=Dmel; length=191; MKLVLVVLLGCCFIGQLTNTQLVYKLKKIECLVNRTRVSNVSCHVKAINW NLAVVNMDCFMIVPLHNPIIRMQVFTKDYSNQYKPFLVDVKIRICEVIER RNFIPYGVIMWKLFKRYTNVNHSCPFSGHLIARDGFLDTSLLPPFPQGFY QVSLVVTDTNSTSTDYVGTMKFFLQAMEHIKSKKTHNLVHN >FBpp0070770 type=protein; loc=X:join(5584802..5585021,5585925..5586137,5586198..5586342,5586410..5586605); ID=FBpp0070770; name=cv-PA; parent=FBgn0000394,FBtr0070804; dbxref=FlyBase:FBpp0070770,FlyBase_Annotation_IDs:CG12410-PA,GB_protein:AAF46063.1,GB_protein:AAF46063; MD5=0626ee34a518f248bbdda11a211f9b14; release=r5.1; species=Dmel; length=257; MEIWRSLTVGTIVLLAIVCFYGTVESCNEVVCASIVSKCMLTQSCKCELK NCSCCKECLKCLGKNYEECCSCVELCPKPNDTRNSLSKKSHVEDFDGVPE LFNAVATPDEGDSFGYNWNVFTFQVDFDKYLKGPKLEKDGHYFLRTNDKN LDEAIQERDNIVTVNCTVIYLDQCVSWNKCRTSCQTTGASSTRWFHDGCC ECVGSTCINYGVNESRCRKCPESKGELGDELDDPMEEEMQDFGESMGPFD GPVNNNY … Reformatting Data Files • Much of the routine (yet annoying) work of bioinformatics involves messing around with data files to get them into formats that will work with various software • Then messing around with the results produced by that software to create a useful summary… Public Sequence Databases • Three major repositories: – NCBI (www.ncbi.nlm.nih.gov) – EBI (www.ebi.ac.uk) – DDBJ (www.dbj.nig.ac.jp) • Same sequence information in all three, but different tools for searching and retrieval GenBank • Contains all DNA and protein sequences described in the scientific literature or collected in publicly funded research • Flatfile: Composed entirely of text • Each submitted sequence is a record • Had fields for Organism, Date, Author, etc. • Unique identifier for each sequence – Locus and Accession # Fields Accession Numbers!! • Databases are designed to be searched by accession numbers (and locus IDs) • These are guaranteed to be non-redundant, accurate, and not to change. • Searching by gene names and keywords is doomed to frustration and probable failure • Neither scientists nor computers can be trusted to accurately and consistently annotate database entries!! http://www.ncbi.nlm.nih.gov/Genbank • Once upon a time, GenBank mailed out sequences on CD-ROM disks a few times per year. • At least doubles in size every 18 months • There are approximately 106,533,156,756 bases in 108,431,692 sequence records in the traditional GenBank divisions and 148,165,117,763 bases in 48,443,067 sequence records in the WGS division as of August 2009. A few words about RefSeq • Many sequences in GenBank correspond to the same gene • genomic clones, full length mRNA, various kinds of ESTs, submitted by different investigators • RefSeq is the “Reference Sequence” for a gene - as determined by GenBank curators – best guess given the current evidence, can change – usually based on the longest mRNA – usually has both 5’ and 3’ UTR • Not necessarily reliable – A lot is not yet known… eg, alternative splicing Many Datasets at NCBI • The NCBI hosts a huge interconnected database system that, in addition to DNA and protein, includes: – Journal Articles (PubMed) – Genetic Diseases (OMIM) – Polymorphisms (dbSNP) – Cytogenetics (CGH/SKY/FISH & CGAP) – Gene Expression (GEO) – Taxonomy – Chemistry (PubChem) Web Query • Most databases have a web-based query tool • It may be simple… … or complex ENTREZ is the GenBank web query tool Advanced query interface: ENTREZ has pre-computed links between Tables •Relationships between sequences are computed with BLAST •Relationships between articles are computed with "MESH" terms (shared keywords) •Relationships between DNA and protein sequences rely on accession numbers •Relationships between sequences and PubMed articles rely on both shared keywords and the mention of accession numbers in the articles. NAR Database Issue • Online collection of biological databases: http://www3.oup.co.uk/nar/database/c/ UCSC Genome Browser Search by gene name: or by sequence: Lots of additional data can be added as optional "tracks" - anything that can be mapped to locations on the genome Ensembl at EBI/EMBL KEGG: Kyoto Encylopedia of Genes and Genomes • Enzymatic and regulatory pathways • Mapped out by EC number and crossreferenced to genes in all known organisms (wherever sequence information exits) • Parallel maps of regulatory pathways Genome Ontology • Biology is a messy science • Assortment of names, mutants, odd phenotypes – “sonic hedgehog” • Genome Ontology – Molecular function (specific tasks) – Biological process (broad biological goal) – Cellular component (location) Database Searching A database can only be searched in ways that it was designed to be searched Boolean: "AND" and "OR" searches Bad to search for "human hemoglobin" in a 'Description' field Much better to search for "homo sapiens in 'Organism' AND "HBB" in 'gene name' Strategies • Use accession numbers whenever possible • Start with broad keywords and narrow the search using more specific terms • Try variants of spelling, numbers, etc. • Search all relevant databases • Be persistent!! Golden Rules • Use published databases and methods – Supported, maintained, trusted by community • Document what you have done !!! – Sequence identification numbers – Server, database, program VERSION – Program parameters • Assess reliability of results