* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Download DAAM1 antibody - middle region (ARP55131_P050)
Immunoprecipitation wikipedia , lookup
G protein–coupled receptor wikipedia , lookup
Protein (nutrient) wikipedia , lookup
Cell-penetrating peptide wikipedia , lookup
Magnesium transporter wikipedia , lookup
Ribosomally synthesized and post-translationally modified peptides wikipedia , lookup
Interactome wikipedia , lookup
Secreted frizzled-related protein 1 wikipedia , lookup
Nuclear magnetic resonance spectroscopy of proteins wikipedia , lookup
Gene therapy of the human retina wikipedia , lookup
Silencer (genetics) wikipedia , lookup
Gene expression wikipedia , lookup
Gene nomenclature wikipedia , lookup
Vectors in gene therapy wikipedia , lookup
Expression vector wikipedia , lookup
Bottromycin wikipedia , lookup
Protein adsorption wikipedia , lookup
Protein moonlighting wikipedia , lookup
Artificial gene synthesis wikipedia , lookup
Protein–protein interaction wikipedia , lookup
Gene regulatory network wikipedia , lookup
DAAM1 antibody - middle region (ARP55131_P050) Data Sheet Product Number Product Name Size Gene Symbol Alias Symbols Nucleotide Accession# Protein Size (# AA) Molecular Weight Product Format NCBI Gene Id Host Clonality Official Gene Full Name Description Peptide Sequence Target Reference Description of Target Partner Proteins Reconstitution and Storage Lead Time Blocking Peptide Immunogen Swissprot Id Protein Name Protein Accession # Purification Species Reactivity Application Predicted Homology Based on Immunogen Sequence ARP55131_P050 DAAM1 antibody - middle region (ARP55131_P050) 50ug DAAM1 FLJ41657; KIAA0666 NM_014992 1078 amino acids 123kDa Lyophilized powder 23002 Rabbit Polyclonal Dishevelled associated activator of morphogenesis 1 This is a rabbit polyclonal antibody against DAAM1. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Synthetic peptide located within the following region: GNTVQYWLLLDRIIQQIVIQNDKGQDPDSTPLENFNIKNVVRMLVNENEV Higashi,T., (2008) J. Biol. Chem. 283 (13), 8746-8755 Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the Formin homology (FH) proteins in these processes. The protein encoded by this gene contains FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein.Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the Formin homology (FH) proteins in these processes. The protein encoded by this gene contains FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein. Evidence of alternative splicing has been observed for this gene but the full-length nature of these variants has not been determined. APTX, MAPK10, MAPK8, MAPK9 Add 50 ul of distilled water. Final anti-DAAM1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Domestic: within 24 hours delivery International: 3-5 business days For anti-DAAM1 antibody is Catalog # AAP55131 (Previous Catalog # AAPP32749) The immunogen for anti-DAAM1 antibody: synthetic peptide directed towards the middle region of human DAAM1 Q9Y4D1 Disheveled-associated activator of morphogenesis 1 NP_055807 Affinity Purified Bovine, Human, Rat, Pig, Horse, Rabbit, Guinea pig, Mouse, Dog, Zebrafish WB Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 86% Human 293T WB Suggested Anti-DAAM1 Antibody Titration: 0.2-1 ug/ml Image 1 ELISA Titer: 1:62500 Positive Control: 293T cell lysate __________________________________________________________________________________________________________________________________________________________________ This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.