Download DAAM1 antibody - middle region (ARP55131_P050)

DAAM1 antibody - middle region (ARP55131_P050)
Data Sheet
Product Number
Product Name
Size
Gene Symbol
Alias Symbols
Nucleotide Accession#
Protein Size (# AA)
Molecular Weight
Product Format
NCBI Gene Id
Host
Clonality
Official Gene Full Name
Description
Peptide Sequence
Target Reference
Description of Target
Partner Proteins
Reconstitution and
Storage
Lead Time
Blocking Peptide
Immunogen
Swissprot Id
Protein Name
Protein Accession #
Purification
Species Reactivity
Application
Predicted Homology
Based on Immunogen
Sequence
ARP55131_P050
DAAM1 antibody - middle region (ARP55131_P050)
50ug
DAAM1
FLJ41657; KIAA0666
NM_014992
1078 amino acids
123kDa
Lyophilized powder
23002
Rabbit
Polyclonal
Dishevelled associated activator of morphogenesis 1
This is a rabbit polyclonal antibody against DAAM1. It was validated on Western Blot using a cell lysate as a
positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein
family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a
target protein. For availability of antibody needed for your experiment, please inquire ().
Synthetic peptide located within the following region:
GNTVQYWLLLDRIIQQIVIQNDKGQDPDSTPLENFNIKNVVRMLVNENEV
Higashi,T., (2008) J. Biol. Chem. 283 (13), 8746-8755
Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of
the actin cytoskeleton and recent evidence suggests a role for the Formin homology (FH) proteins in these
processes. The protein encoded by this gene contains FH domains and belongs to a novel FH protein subfamily
implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton
architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex
formation, an assembly mediated by this gene product, which is thought to function as a scaffolding
protein.Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the
reorganization of the actin cytoskeleton and recent evidence suggests a role for the Formin homology (FH)
proteins in these processes. The protein encoded by this gene contains FH domains and belongs to a novel FH
protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of
cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho
complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding
protein. Evidence of alternative splicing has been observed for this gene but the full-length nature of these
variants has not been determined.
APTX, MAPK10, MAPK8, MAPK9
Add 50 ul of distilled water. Final anti-DAAM1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Domestic: within 24 hours delivery International: 3-5 business days
For anti-DAAM1 antibody is Catalog # AAP55131 (Previous Catalog # AAPP32749)
The immunogen for anti-DAAM1 antibody: synthetic peptide directed towards the middle region of human
DAAM1
Q9Y4D1
Disheveled-associated activator of morphogenesis 1
NP_055807
Affinity Purified
Bovine, Human, Rat, Pig, Horse, Rabbit, Guinea pig, Mouse, Dog, Zebrafish
WB
Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig:
100%; Dog: 93%; Zebrafish: 86%
Human 293T
WB Suggested Anti-DAAM1 Antibody Titration:
0.2-1 ug/ml
Image 1
ELISA Titer: 1:62500
Positive Control: 293T cell lysate
__________________________________________________________________________________________________________________________________________________________________
This product is for Research Use Only. Not for diagnostic, human, or veterinary use.
Optimal conditions of its use should be determined by end users.