* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Download Recombinant Human Olfactory Marker Protein ab140735 Product datasheet 1 Image
Molecular evolution wikipedia , lookup
Expanded genetic code wikipedia , lookup
Biochemistry wikipedia , lookup
Ribosomally synthesized and post-translationally modified peptides wikipedia , lookup
Genetic code wikipedia , lookup
Index of biochemistry articles wikipedia , lookup
Gene expression wikipedia , lookup
G protein–coupled receptor wikipedia , lookup
Artificial gene synthesis wikipedia , lookup
Cell-penetrating peptide wikipedia , lookup
Magnesium transporter wikipedia , lookup
List of types of proteins wikipedia , lookup
Ancestral sequence reconstruction wikipedia , lookup
Point mutation wikipedia , lookup
Interactome wikipedia , lookup
Protein moonlighting wikipedia , lookup
Expression vector wikipedia , lookup
Homology modeling wikipedia , lookup
Nuclear magnetic resonance spectroscopy of proteins wikipedia , lookup
Protein (nutrient) wikipedia , lookup
Western blot wikipedia , lookup
Protein structure prediction wikipedia , lookup
Protein–protein interaction wikipedia , lookup
Protein adsorption wikipedia , lookup
Product datasheet Recombinant Human Olfactory Marker Protein ab140735 1 Image Overview Product name Recombinant Human Olfactory Marker Protein Protein length Full length protein Description Nature Recombinant Source E. coli Amino Acid Sequence Accession P47874 Species Human Sequence MGSSHHHHHHSSGLVPRGSHMGSMAEDRPQQPQLDMPLVLDQGLTRQMRL RVESLKQRGEKRQDGEKLLQPAESVYRLNFTQQQRLQFERWNVVLDKPGK VTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGE RLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL Molecular weight 21 kDa including tags Amino acids 1 to 163 Tags His tag N-Terminus Specifications Our Abpromise guarantee covers the use of ab140735 in the following tested applications. The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user. Applications SDS-PAGE Mass Spectrometry Mass spectrometry MALDI-TOF Purity >95% by SDS-PAGE . ab140735 was purified using conventional chromatography techniques. Form Liquid Preparation and Storage 1 Stability and Storage Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or 80°C. Avoid freeze / thaw cycle. pH: 8.00 Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride General Info Relevance Olfactory marker protein (OMP) is an abundant, 19kDa, cytosolic protein that is almost exclusively expressed in mature, functioning, olfactory neurons but not in the neural precursor basal cells. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human. Its tissue specific expression in the receptor cells together with the results of the mouse knockout studies show that OMP represents a novel modulatory component of the odor detection/signal transduction cascade. Cellular localization Cytoplasmic Recombinant Human Olfactory Marker Protein images 15% SDS-PAGE analysis of ab140735 (3µg). SDS-PAGE - Olfactory Marker Protein (His tag) (ab140735) Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE" Our Abpromise to you: Quality guaranteed and expert technical support Replacement or refund for products not performing as stated on the datasheet Valid for 12 months from date of delivery Response to your inquiry within 24 hours We provide support in Chinese, English, French, German, Japanese and Spanish Extensive multi-media technical resources to help you We investigate all quality concerns to ensure our products perform to the highest standards If the product does not perform as described on this datasheet, we will offer a refund or replacement. For full details of the Abpromise, please visit http://www.abcam.com/abpromise or contact our technical team. Terms and conditions 2 Guarantee only valid for products bought direct from Abcam or one of our authorized distributors 3