* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Download Recombinant Human PKA 2 beta (regulatory subunit) protein
Endogenous retrovirus wikipedia , lookup
Artificial gene synthesis wikipedia , lookup
Genetic code wikipedia , lookup
Monoclonal antibody wikipedia , lookup
Silencer (genetics) wikipedia , lookup
Lipid signaling wikipedia , lookup
Biochemistry wikipedia , lookup
Metalloprotein wikipedia , lookup
Gene expression wikipedia , lookup
Point mutation wikipedia , lookup
Mitogen-activated protein kinase wikipedia , lookup
Magnesium transporter wikipedia , lookup
Ancestral sequence reconstruction wikipedia , lookup
Expression vector wikipedia , lookup
Interactome wikipedia , lookup
Paracrine signalling wikipedia , lookup
Signal transduction wikipedia , lookup
Homology modeling wikipedia , lookup
G protein–coupled receptor wikipedia , lookup
Nuclear magnetic resonance spectroscopy of proteins wikipedia , lookup
Gene regulatory network wikipedia , lookup
Protein purification wikipedia , lookup
Protein–protein interaction wikipedia , lookup
Proteolysis wikipedia , lookup
Product datasheet Recombinant Human PKA 2 beta (regulatory subunit) protein ab152631 1 Image Overview Product name Recombinant Human PKA 2 beta (regulatory subunit) protein Protein length Protein fragment Description Nature Recombinant Source Wheat germ Amino Acid Sequence Accession P31323 Species Human Sequence IAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGEL ALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQL VALFGTNMDI Molecular weight 38 kDa including tags Amino acids 304 to 413 Specifications Our Abpromise guarantee covers the use of ab152631 in the following tested applications. The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user. Applications SDS-PAGE Western blot ELISA Form Liquid Additional notes Protein concentration is above or equal to 0.05 µg/µl. Preparation and Storage Stability and Storage Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00 Constituents: 0.31% Glutathione, 0.79% Tris HCl 1 General Info Function Regulatory subunit of the cAMP-dependent protein kinases involved in cAMP signaling in cells. Type II regulatory chains mediate membrane association by binding to anchoring proteins, including the MAP2 kinase. Tissue specificity Four types of regulatory chains are found: I-alpha, I-beta, II-alpha, and II-beta. Their expression varies among tissues and is in some cases constitutive and in others inducible. Sequence similarities Belongs to the cAMP-dependent kinase regulatory chain family. Contains 2 cyclic nucleotide-binding domains. Post-translational modifications Phosphorylated by the activated catalytic chain. Cellular localization Cytoplasm. Cell membrane. Co-localizes with PJA2 in the cytoplasm and at the cell membrane. Recombinant Human PKA 2 beta (regulatory subunit) protein images 12.5% SDS-PAGE showing ab152631 stained with Coomassie Blue. SDS-PAGE - PKA 2 beta (regulatory subunit) protein (Tagged) (ab152631) Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE" Our Abpromise to you: Quality guaranteed and expert technical support Replacement or refund for products not performing as stated on the datasheet Valid for 12 months from date of delivery Response to your inquiry within 24 hours We provide support in Chinese, English, French, German, Japanese and Spanish Extensive multi-media technical resources to help you We investigate all quality concerns to ensure our products perform to the highest standards If the product does not perform as described on this datasheet, we will offer a refund or replacement. For full details of the Abpromise, please visit http://www.abcam.com/abpromise or contact our technical team. Terms and conditions Guarantee only valid for products bought direct from Abcam or one of our authorized distributors 2