* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Download Bacterial_Resistance
Nutriepigenomics wikipedia , lookup
Point mutation wikipedia , lookup
Vectors in gene therapy wikipedia , lookup
Metagenomics wikipedia , lookup
Saethre–Chotzen syndrome wikipedia , lookup
Gene expression profiling wikipedia , lookup
Pathogenomics wikipedia , lookup
Epigenetics of diabetes Type 2 wikipedia , lookup
Gene therapy of the human retina wikipedia , lookup
History of genetic engineering wikipedia , lookup
Genetic engineering wikipedia , lookup
Gene therapy wikipedia , lookup
Gene expression programming wikipedia , lookup
Gene desert wikipedia , lookup
No-SCAR (Scarless Cas9 Assisted Recombineering) Genome Editing wikipedia , lookup
Neuronal ceroid lipofuscinosis wikipedia , lookup
Therapeutic gene modulation wikipedia , lookup
Pharmacogenomics wikipedia , lookup
Public health genomics wikipedia , lookup
Genetically modified crops wikipedia , lookup
Gene nomenclature wikipedia , lookup
Microevolution wikipedia , lookup
Designer baby wikipedia , lookup
Helitron (biology) wikipedia , lookup
Bacterial Resistance Problem Space Ehren Bucholtz Saint Mary-of-the-Woods College Mark Gallo Niagara University Background • Microbial drug resistance (DR) is a growing concern among health professionals and others around the world. • DR Issues that can be studied in a problem space environment include – Types of Drug classes – Types of Bacteria – Mechanism of Action – Mechanisms of DR Microbial drug resistance Biological Principles Next slide Drug Resistance Tools Biology Workbench NCBI Data Sets CDC FDA Drug Digest RxList Coevolution Genetic exchange Phylogeny Ecological Factors Drug Classes Bacteria types Host interaction Antibacterials Antibiotics Drug Resistance Mutations Cellular level Resistance Mechanisms Mechanism of Action Bacteriocidal Bacteriostatic Resources • Centers for Disease Control – Case studies – Outbreak data • Genbank • Biology Workbench Multidrug Resistance Region of Salmonella enterica Serovar Typhimurium DT104 • Outbreaks of MDR Typhimurium DT104 have also been reported in poultry, beef, cheese, and swine in numerous countries • Resistant to ampicillin, chloramphenicol, streptomycin, sulfonamides, and tetracycline • however, isolates have been identified which are also resistant to fluoroquinolones, trimethoprim, and kanamycin • antimicrobial resistance gene is clustered on a fragment of less than 46 kb Task: Identify Resistance ORFs • Students are given pieces of nucleotide sequence of SGi1 to identify homology – – – – beta-lactamase Tetracycline resistance Integrase Transposase • beta_lactamase (partial sequence shown) NEGKLGDLRDTTTPKAIAS TLNKFLFGSALSEMNQKKL ESWMVNNQVTGNLLRSVLP AGW Find results for • 4377727_4377728Vibrio cholerae non O1, non O139 plasmid class A beta-lactamase • 216842_216843Proteus mirabilis plasmid pCS229 blaP gene for bata-lactamase, • 30314015_30314018Pasteurella multocida plasmid pJR2, complete sequence. • 9719055_9719057Vibrio cholerae class 1 integron integrase (intI1) gene,partial • 12719011_12719033Salmonella enterica subsp. enterica serovar Typhimurium genomic • 151074_151076P.aeruginosa beta-lactamase (PSE-1) gene, complete cds • 47647_47648S.typhimurium beta-lactamase gene. BlastP and Clustal for beta lactamase unknown • • • • • • • • • 30314015_3031401 216842_216843 47647_47648 151074_151076 12719011_12719033 9719055_9719057 beta_lactamase 4377727_4377728 NEGKLGDLRDTTTPKAIASTLNKFLFGSALSEMNQKKLESWMVNNQVTGNLLRSVLPAGW NEGKLGDLRDTTTPKAIASTLNKFLFGSALSEMNKKKLESWMVNNQVTGNLLRSVLPAGW NEGKLGDLRDTTTPKAIASTLNKFLFGSALSEMNQKKLESWMVNNQVTGNLLRSVLPAGW NEGKLGDLRDTTTPKAIASTLNKFLFGSALSEMNQKKLESWMVNNQVTGNLLRSVLPAGW NEGKLGDLRDTTTPKAIASTLNKFLFGSALSEMNQKKLESWMVNNQVTGNLLRSVLPAGW NEGKLGDLRDTTTPKAIASTLNKFLFGSALSEMNQKKLESWMVNNQVTGNLLRSVLPAGW NEGKLGDLRDTTTPKAIASTLNKFLFGSALSEMNQKKLESWMVNNQVTGNLLRSVLPAGW NEGKLGDLRDTTTPKAIASTLNQLLFGSTLSEASQKKLESWMVNNQVTGNLLRSVLPVKW **********************::****:*** .:**********************. * Rooted Tree from ClustalW Other project ideas • Use wealth of CDC case study data to fill out project space CDC Case Study • Variant Salmonella Genomic Island 1 Antibiotic Resistance Gene Cluster in Salmonella enterica Serovar Albany – Benoît Doublet et.al. Emerg Infect Dis 2003 May Available from: URL: http://www.cdc.gov/ncidod/EID/vol9no5/02-0609.htm Something’s fishy • A variant SGI1, Salmonella genomic island 1, was identified as an antibiotic-resistance gene cluster in a multidrug-resistant strain of S. enterica serovar Albany isolated from food fish from Thailand and imported to France. • In this strain, the streptomycin resistance aadA2 gene cassette in one of the SGI1 integrons was replaced by a dfrA1 gene cassette, conferring resistance to trimethoprim and an open reading frame of unknown function. Gene Function Treasure Hunt • Clustering of Salmonella isolates