* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Download Bio 251 07 TLN Genet..
Two-hybrid screening wikipedia , lookup
Genetic engineering wikipedia , lookup
RNA interference wikipedia , lookup
Personalized medicine wikipedia , lookup
Metalloprotein wikipedia , lookup
RNA silencing wikipedia , lookup
Silencer (genetics) wikipedia , lookup
Deoxyribozyme wikipedia , lookup
Artificial gene synthesis wikipedia , lookup
Amino acid synthesis wikipedia , lookup
Polyadenylation wikipedia , lookup
Proteolysis wikipedia , lookup
Nucleic acid analogue wikipedia , lookup
Biochemistry wikipedia , lookup
Gene expression wikipedia , lookup
Point mutation wikipedia , lookup
Messenger RNA wikipedia , lookup
Transfer RNA wikipedia , lookup
Biosynthesis wikipedia , lookup
Single-letter code: M D L Y The Genetic Code How the genetic code was deduced is quite an interesting but horribly complicated story of prokaryotic genetics. I’ll just give you the Cliff notes version: Francis Crick and Sidney Brenner figured out that: The genetic code maps ‘codons’ of 3 bases into one amino acid. AUA -> Ile GAU -> Asp AGA -> Arg mRNA -> Amino Acid The Genetic Code Crick and Brenner figured out that: The DNA code is read sequentially from a fixed position in the gene The mechanism and machinery for translating a protein Three components: Translation Requires: Ґ Message in the form of mRNA Й Ґ A RibosomeЙ .. Ґ Another type of RNA Й called Transfer RNA ( tRNA) Ґ A pool of amino acids in cytoplasm AA1 AA2 AA3 Free Amino Acids mRNA, rRNA, tRNA and protein synthesis In translation, the language of nucleic acids is translated into a new language, that of proteins mRNA provides the code, in linear digital form, for making a protein tRNA provides an adaptor that links the code in a polynucleotide chain to amino acids that make up the polypeptide chain rRNA and ribosomes provide the decoder. Ribosomes bring together mRNA and tRNA, and catalyze the translation of an mRNA into a polypeptide chain. Ribosomes are the site of protein synthesis. Ribosomes create peptide bonds between amino acids to create proteins tRNA is the adapter. Amino acid is matched to the Anti-codon. Complementary to the Codon 3’ 5’ Two views of the adaptor molecule, transfer RNA (tRNA), which guides amino acids to the mRNA-ribosome complex 5’ 3’ The anticodon of the tRNA aligns with the codon in mRNA through complementary base pairing Translation occurs 5’ to 3’ Is tRNA orientation with mRNA correct as drawn? Translation is performed with the help of the Ribosome. RNA is the major component of the Ribosome. About 2/3 of the Ribosome is RNA by mass. These RNA molecules are called rRNA and they play a central role in the translation of mRNA into polypeptides. Ribosomal RNAs (rRNAs) form complex 2o and 3o structures that are essential for their function What does this rRNA molecule look like in three dimensions? 3-D model of 16s rRNA molecule as it folds in the ribosome… …and overlaid with its protein subunits Behold, the large subunit containing the 23s + 5s rRNAs Proteins are blue, RNAs are red and white Translation - Initiation fMet Large subunit E P A UAC 5’GAG...CU-AUG--UUC--CUU--AGU--GGU--AGA--GCU--GUA--UGA-AT GCA...TAAAAAA Small mRNA subunit 3’ Translation - Elongation Polypeptide Arg Met Phe Leu Ser Aminoacyl tRNA Gly Ribosome E P A CCA 5’GAG...CU-AUG--UUC--CUU--AGU--GGU--AGA--GCU--GUA--UGA-AT GCA...TAAAAAA mRNA 3’ Translation - Elongation Polypeptide Met Phe Leu Ser Gly Arg Aminoacyl tRNA Ribosome E P A CCA UCU 5’GAG...CU-AUG--UUC--CUU--AGU--GGU--AGA--GCU--GUA--UGA-AT GCA...TAAAAAA mRNA 3’ Translation - Elongation Polypeptide Met Phe Leu Ser Gly Arg Ribosome E P A CCA UCU 5’GAG...CU-AUG--UUC--CUU--AGU--GGU--AGA--GCU--GUA--UGA-AT GCA...TAAAAAA mRNA 3’ Translation - Elongation Polypeptide Met Phe Leu Ala Ser Gly Aminoacyl tRNA Arg Ribosome E P A CCA UCU 5’GAG...CU-AUG--UUC--CUU--AGU--GGU--AGA--GCU--GUA--UGA-AT GCA...TAAAAAA mRNA 3’ Translation - Elongation Polypeptide Met Phe Leu Ser Gly Arg Ribosome E Ala P A UCU CGA 5’GAG...CU-AUG--UUC--CUU--AGU--GGU--AGA--GCU--GUA--UGA-AT GCA...TAAAAAA mRNA 3’ Translation - Termination Met Phe Leu Ser Gly Polypeptide Arg Ala Ribosome Val E P A CGA CGA GCA...TAAAAAA STOP 5’GAG...CU-AUG--UUC--CUU--AGU--GGU--AGA--GCU--GUA--UGA-AT mRNA 3’ Translation - Termination Met Phe Leu Ser Gly Polypeptide Arg Ala Val 5’GAG...CU-AUG--UUC--CUU--AGU--GGU--AGA--GCU--GUA--UGA-AT GCA...TAAAAAA 3’ mRNA STOP Translation normally occurs on polyribosomes, or polysomes This allows for amplification of the signal from DNA and RNA, i.e.,… One gene copy Hundreds of mRNAs Thousands of proteins Translation: the movie How many bases are required to make a genetic code to serve 20 different amino acids? # of 2-base combos = 42 = 16 Not enough! # of 3-base combos = 43 = 64 Too many! What is the solution? How? Evolve a code that is redundant! Degeneracy at the third codon position Let’s look at the Genetic Code Transfer RNA (tRNA) and the genetic code Many different base modifications occur in tRNA Why are these modifications necessary? Transfer RNA (tRNA) and the genetic code Legitimate G-U bp Wobble bp Inosine can pair legitimately with three other bases, when inosine is in the wobble position, i.e., the first, or 5’ base of the anticodon How many chemical changes are required to convert guanine to Inosine? How many chemical changes are required to convert adenine to Inosine? Is there a logic to the Genetic Code? 8 codon families where the third codon position is fully degenerate, i.e, any of the four bases has the same meaning: (4-fold degeneracy) AC__ Thr GC__ Ala CU__ Leu UC__ Ser GG__ Gly GU__ Val CC__ Pro CG__ Arg Thus, for these 8 amino acids, substituting one base for another at the 3rd position is a SYNONYMOUS change Is there a logic to the Genetic Code? 7 codon pairs where meaning is the same whichever pyrimidine occurs at 3rd position: (2-fold degeneracy) UAU UAC Tyr UGU UGC Cys AGU Ser AGC UUU UUC Phe CAU CAC His GAU Asp GAC AAU AAC Asn 5 codon pairs where purines in the 3rd position are interchangeable: (2-fold degeneracy) AGA AGG Arg AAA AAG Lys GAA GAG Glu CAA CAG Gln UUA UUG Leu Therefore, half of 3rd position substitutions will be SYNONYMOUS and half will be NON-SYNONYMOUS The logic of the Genetic Code 8 families with 4-fold degeneracy = 32 codons 12 families with 2-fold degeneracy = 24 codons This accounts for 17 amino acids: - Trp (UGG) and Met (AUG) are specified by unique codons (non-degenerate codons) - What’s left? -- How is Ile specified? Isoleucine (Ile) (This is one of today’s homework questions) + 3 STOP codons (UAA, UGA, UAG) = a 64 total codons Point mutations Point mutations can affect protein structure and function Type of point mutations: - substitutions (missense and nonsense mutations) - insertions and deletions (frameshift mutations) Frame Shift Mutations What happens when you get insertions or deletions of bases in the DNA sequence? Usually you end up with a mess. THE BIG FAT CAT ATE THE RAT AND GOT ILL Deletion of one base THE IGF ATC ATA TET HER ATA NDG OTI LL And its all pops and buzzes. Usually frame shift mutations result in premature stop codons. Relationship between genes and proteins Example of a monogenic, or single-gene disorder What is wrong with the mouse on the right? Alkaptonuria, aka Black Urine disease, in humans Symptoms: - urine and ear wax turns black as ink shortly after exposure to air -ochronosis: musculoskeletal effects, including progressive degenerative arthritis of the large joints, esp. hip and shoulder - signs of ochronosis: -black deposits in the sclerae (white of eye) -blue colored auricles (ear lobes) What is the gene defect, or molecular genetic basis, in alkaptonuria? - four point mutations occur in the human HGO gene - Blastp comparison of HGO gene from human and fungus RVTLPDGPVRGYICELYQGHYQLPELGPIGSNGLANARDFQAPVAAFDDEEGPTE 247 + + + RGYI E+Y H++LP+LGPIG+NGLAN RDF P+A ++D + P SIDVFE-ETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGG 242 T196fs (frameshift) P230S (missense) KFNNHLFSARQDHTPFDIVAWHGNYYPYKYDLGRFNTMGSVSFDHPDPSIYTVLT 307 K+ LF+A+QD +PF++VAWHGNY PYKY+L F + SV+FDHDPSI+ TVLT KYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLT 302 (missense) V300G VGTAIADFVIFPPRWLVAEKTFRPPWYHRNTMSEFMGLITGNYDAKTGGGFQPAG 367 G AIADFVIFPPRW VA+KTFRPP+YHRN MSEFMGLI G+Y+AK GGF P G PGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHYEAKQ-GGFLPGG 361 R321X (nonsense) Are any of the sites in these proteins functionally constrained? Molecular basis of Alkaptonuria Mutations: Proline230Serine and Valine300Glycine account for most cases of the disorder Haplotypes: each of these two mutant alleles constitutes a haplotype, i.e., one haploid type. Progeny inherit one haplotype from each parent. Categorize three different types of point mutations 1 GAA … ATA TAC GTA CAT … … ile tyr val his … glu 2 3 TGC TAG … AAA GAA TGG GTT … … lys glu trp val … cys … TCG CCA TGG CCA … … ser pro trp pro… X (stop) Chemical type: Transversion Transversion Transition Informational type: Missense Missense Nonsense Functional type: Deleterious Non-synonymous Nondegenerate site Deleterious Non-synonymous Nondegenerate site Deleterious Non-synonymous Nondegenerate site Categorize three more types of point mutations 4 5 GTC … ATA TAC GTA CAT … … ile tyr val his … 6 TGC A … AAA GAA TGT GTT … … lys glu cys val … val cys … TCG CCA TGG CCA … … ser pro trp pro … … TCG CAC ATG GCC A … … ser his met gly … Chemical type: Transversion Transition Indel (insertion) Informational type: Missense Missense Frameshift Functional type: Neutral (silent) Synonymous (4-fold degenerate site) Neutral Synonymous (2-fold degenerate site) Deleterious Non-synonymous Is a 4-fold degenerate site ever functionally constrained? Where can you get more information about the basic concepts embedded within the Central Dogma of Molecular Biology? Here is a great site, full of simple, clear, and animated (!) tutorials: http://www.dnaftb.org/dnaftb/ Chapters 15-28 in this series provides an excellent review of the first group of lectures in Bioinformatics: http://www.dnaftb.org/dnaftb/15/concept/ Homework #5 : due Monday, Feb. 12 Express fractions as a % Ribosomes are large ribonucleoprotein (RNP) complexes They are complex affairs, composed of an array of RNA + proteins