* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Download ProteinPrediction
Amino acid synthesis wikipedia , lookup
Biosynthesis wikipedia , lookup
Ribosomally synthesized and post-translationally modified peptides wikipedia , lookup
Paracrine signalling wikipedia , lookup
Genetic code wikipedia , lookup
Gene expression wikipedia , lookup
Point mutation wikipedia , lookup
Magnesium transporter wikipedia , lookup
Expression vector wikipedia , lookup
G protein–coupled receptor wikipedia , lookup
Ancestral sequence reconstruction wikipedia , lookup
Bimolecular fluorescence complementation wikipedia , lookup
Biochemistry wikipedia , lookup
Interactome wikipedia , lookup
Metalloprotein wikipedia , lookup
Protein purification wikipedia , lookup
Western blot wikipedia , lookup
Structural alignment wikipedia , lookup
Two-hybrid screening wikipedia , lookup
Protein Structure Prediction and Structural Genomics Computer Science Department North Dakota State University Fargo, ND Outline    Structure of Protein Prediction Methods CASP Cup 2 Protein Polypeptide sequence  Proteins are synthesized as linear chains of amino acids, but they quickly fold into a compact, globular structure. 3 Peptide bond formation:    Each amino acid has two parts, a backbone and a side chain. The side chain, R, distinguishes the different amino acids. Backbone is constant for all 20 amino acids. It consists of an amide (--NH2) group, an alpha carbon, and a carboxylic acid (-COOH) group. 4 The Amino Acids list Group Code Group Name 1 Gly Glycine 2 Ala Alanine 3 Val Valine 4 Leu Leucine 5 Ile Isoleucine 6 Ser Serine 7 Thr Threonine 8 Cys Cysteine 9 Met Methionine 10 Pro Proline 11 Asp Aspartic acid 12 Asn Asparagine 13 Glu Glutamic acid 14 Gln Glutamine 15 His Histidine 16 Lys Lysine 17 Arg Arginine 18 Phe Phenylalanine 19 Tyr Tyrosine 20 Trp Tryptophan ID 5 Protein Primary structure:  Protein Primary Sequences can be written with a 3-letter code for the 20 amino acids (above) or with a 1-letter code: Ex: Human Insulin A-Chain: GIVEQCCTSICSLYQLENYCN B-Chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT 6 Protein Secondary structure   Protein secondary structure refers to regular, repeated patters of folding of the protein backbone. Patterns result from regular hydrogen bond patterns of backbone atoms. 7 Protein Secondary Structure  The two most common folding patterns are the alpha helix and the beta sheet. 8  Two elements of secondary structure are alpha helices (= =60o) and beta strands (= -135o,=135o), which associate with other beta strands to form parallel or anti-parallel beta sheets -helix antiparallel -sheet 9 Secondary Structure  Only two rotatable bonds in protein   The bond between the amide nitrogen and the alpha carbon, referred to as  (phi) angle The bond between the alpha carbon and the carboxyl carbon, referred to as  (psi) angle 10 Protein Tertiary Structure  Final shapes of proteins are determined and stabilized by chemical bonds and forces, including weak bonds like Hydrogen bonds, Ionic bonds, Van der Waals bonds, and Hydrophobic attractions. Tertiary Structure of Ribonuclease: A globular protein Alpha helices, beta sheets, and turns contribute to the Ribonuclease A tertiary structure. 11 Protein Quaternary Structure  The arrangement of the individual subunits of a protein with multiple polypeptide subunits gives the protein a quaternary structure   Ex: Hemoglobin has 2 alpha and 2 beta subunits. Only proteins with multiple polypeptide subunits can have quaternary structure. 12 Different protein structure formation: 13 The Goal of Protein Structure Prediction   “The goal of fold assignment and comparative modeling is to assign, using computational methods, each new genome sequence to the known protein fold or structure that it most closely resembles.” In other words, to class structure into families that share similar folds or motifs and to construct phylogenies. 14 Significant    Identifying these shared structural motifs can provide significant insight into the functional mechanisms of the protein family. “The key to understanding the inner workings of cells is to learn the structure of Proteins that form their architecture and carry out their metabolism.” Comparing proteomics with genomics, it is fair to say that “genes were easy” and the real work of bioinformatics has just begun. 15 Protein Classification: Families and superfamilies   By definition, proteins that are more than 50% identical in amino acid sequence across their entire length are said to be members of a single family. Superfamilies are groups of protein families that are related by lower but still detectable levels of sequence similarity (and therefore have a common but more ancient evolutionary origin). 16 Protein Classification: Folds   Proteins are said to have a common fold if they have the same major secondary structures in the same arrangement and with same topological connections. For example, all alpha proteins, all beta proteins, alpha/beta proteins, membrane and cell surface proteins, etc. In many respects, the term fold is used synonymously with structural motif but generally refers to larger combinations of secondary structures. 17 Protein Classification: Enzyme nomenclature  Each enzyme can be assigned a numerical code, such as 3.2.1.14, where the first number specifies the main class, the second and third numbers correspond to specific subclasses, and the final number represents the serial listing of the enzyme in its subclass. 18 Experimental Techniques      X-ray Crystallography NMR Spectroscopy 2D electrophoresis Mass spectrometry Protein microarrays 19 Two Prediction Methods  Protein Folding Model    to simulate the protein folding process at various levels of abstraction which provides insights into the forces that determine protein structure and the folding process. No algorithm developed to date can determine the native structure of a protein accurately. Comparative Modeling  sometimes called homology modeling, seeks to predict the structure of a target protein via comparison with the structures of related proteins. 20 Comparative Modeling Algorithms       DALI (Holm1993) STRUCTAL (Gerstein1996) VAST (Gibrat1996) MINAREA (Falicov1996) LOCK (Singh1997) 3dSEARCH (Singh1998) 21 Prediction Algorithm: 3dSEARCH    Designed to compute fast but approximate alignments of protein structures based on secondary structure elements alone. The fundamental idea is to represent all secondary structure vectors from all target proteins in a large, highly redundant hash table. Each secondary structure vector from a given query structure can be simultaneously compared to the entire table. It performed surprisingly well given the simplicity of its technique. 22 Prediction Algorithm: VAST   Aligning secondary structure elements using graph theory. Steps of VAST Algorithm     All element pairs (one from each protein) that have the same type are represented as nodes. Two nodes are connected if the distance and angle within some threshold. Find the maximal subgraph that are fully connected, which is the pairwise alignment. Compute alignment score as well as P-value. 23 Prediction Algorithm: DALI   Attempt to compute the optimal similar contact patterns from a 2-d distance matrices. Use branch-and-bound algorithm to find an approximate solution. 24 Prediction Algorithm: STRUCTAL   To minimize the root-mean-square difference (RMSD) between two protein backbones. Use dynamic programming to minimize. 25 Prediction Algorithm: MINAREA   To compute a triangulation between the C-a atoms of the two proteins in order to minimize the stretched surface area between their backbones. Use dynamic programming (DP) to find the minimum. 26 Prediction Algorithm: LOCK   Attempt to find the optimal rigid-body superposition of two structures such that root-mean-square difference (RMSD) between the aligned C-a atoms is minimized. An iterative approach that performs a greedy search to the nearest local minimum in alignment space. 27 Gold Standard for Evaluation   Scope database is being widely used and has been recognized as a current standard in structural classification. (http://pdb.wehi.edu.au/scop) It has been constructed by visual inspection of all structures in Protein Data Bank (PDB). Four levels, ‘class’, ‘fold’, superfamily’, and ‘family’. ‘Class’ are those that have similar overall secondary structure content. 28 CASP Competition   CASP competition (Critical Assessment of Techniques for Protein Structure Prediction) http://predictioncenter.llnl.gov/ Their goal is to help advance the methods of identifying protein structure from sequence. 29
 
									 
									 
									 
									 
									 
									 
									 
									 
									 
									 
									 
									 
									 
									 
									 
									 
									 
									 
									 
									 
									 
									 
									 
									 
									 
									 
									 
									 
									 
                                             
                                             
                                             
                                             
                                             
                                             
                                             
                                             
                                             
                                             
                                            