* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Download GRAMD2 antibody - middle region (ARP44634_P050)
Survey
Document related concepts
Protein folding wikipedia , lookup
Protein domain wikipedia , lookup
Protein design wikipedia , lookup
Bimolecular fluorescence complementation wikipedia , lookup
List of types of proteins wikipedia , lookup
Protein structure prediction wikipedia , lookup
Nuclear magnetic resonance spectroscopy of proteins wikipedia , lookup
Homology modeling wikipedia , lookup
Protein–protein interaction wikipedia , lookup
Immunoprecipitation wikipedia , lookup
Protein purification wikipedia , lookup
Transcript
GRAMD2 antibody - middle region (ARP44634_P050) Data Sheet Product Number Product Name Size Gene Symbol Alias Symbols Nucleotide Accession# Protein Size (# AA) Molecular Weight Product Format NCBI Gene Id Host Clonality Official Gene Full Name Description Peptide Sequence ARP44634_P050 GRAMD2 antibody - middle region (ARP44634_P050) 50ug GRAMD2 NM_001012642 354 amino acids 40kDa Lyophilized powder 196996 Rabbit Polyclonal GRAM domain containing 2 This is a rabbit polyclonal antibody against GRAMD2. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Synthetic peptide located within the following region: LPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHLQPSSKKSLSVREF Target Reference Description of Target Reconstitution and Storage Lead Time Blocking Peptide Ota,T., (2004) Nat. Genet. 36 (1), 40-45 Immunogen The immunogen for anti-GRAMD2 antibody: synthetic peptide directed towards the middle region of human GRAMD2 Q8IUY3 Swissprot Id Protein Name Protein Accession # Purification Species Reactivity Application Predicted Homology Based on Immunogen Sequence The exact function of GRAMD2 remains unknown. Add 50 ul of distilled water. Final anti-GRAMD2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Domestic: within 24 hours delivery International: 3-5 business days For anti-GRAMD2 antibody is Catalog # AAP44634 (Previous Catalog # AAPP12106) GRAM domain-containing protein 2 NP_001012660 Affinity Purified Dog, Pig, Guinea pig, Human, Mouse, Rat, Bovine, Horse, Rabbit WB Dog: 100%; Pig: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 86% Human Lung WB Suggested Anti-GRAMD2 Antibody Titration: Image 1 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Lung __________________________________________________________________________________________________________________________________________________________________ This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.