* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Download file
Personalized medicine wikipedia , lookup
Protein–protein interaction wikipedia , lookup
Genetic engineering wikipedia , lookup
Transcriptional regulation wikipedia , lookup
DNA supercoil wikipedia , lookup
Signal transduction wikipedia , lookup
Molecular cloning wikipedia , lookup
Community fingerprinting wikipedia , lookup
Silencer (genetics) wikipedia , lookup
Amino acid synthesis wikipedia , lookup
Gene expression wikipedia , lookup
Genomic library wikipedia , lookup
Proteolysis wikipedia , lookup
Two-hybrid screening wikipedia , lookup
Drug design wikipedia , lookup
Deoxyribozyme wikipedia , lookup
Endogenous retrovirus wikipedia , lookup
Non-coding DNA wikipedia , lookup
Genetic code wikipedia , lookup
Vectors in gene therapy wikipedia , lookup
Protein structure prediction wikipedia , lookup
Nucleic acid analogue wikipedia , lookup
Point mutation wikipedia , lookup
Artificial gene synthesis wikipedia , lookup
Molecular evolution wikipedia , lookup
Biosynthesis wikipedia , lookup
Course website • http://rayl0.bio.uci.edu/seminar • Lecture notes will be posted before the lectures if possible. • Handouts will be passed around for additional information. Contacts • Office hours by appointment • [email protected] • 3206 Natural Sciences I Lecture info • Meeting place: NSI 2144 • Meeting times: Tue 4:00-4:50pm Bio Sci 2B Computer Aided Drug Design What is a drug? • Defined composition with a pharmacological effect • Regulated by the Food and Drug Administration (FDA) • What is the process of Drug Discovery and Development? Drugs and the Discovery Process • Small Organic Molecules – Natural products • fermentation broths • plant extracts • animal fluids (e.g., snake venoms) – Synthetic Medicinal Chemicals • Project medicinal chemistry derived • Combinatorial chemistry derived • Biological Molecules – Natural products (isolation) – Recombinant products Discovery vs. Development • Discovery includes: Concept, mechanism, assay, screening, hit identification, lead demonstration, lead optimization • Discovery also includes In Vivo proof of concept in animals and demonstration of a therapeutic effect • Development begins when the decision is made to put a molecule into phase I clinical trials Discovery and Development • The time from conception to approval of a new drug is typically 10-15 years • The vast majority of molecules fail along the way • The estimated cost to bring to market a successful drug is now $800 million!! (Dimasi, 2000) • However, the annual profit of a drug can be $ 1 billion per year • Pharmaceutical industry has been one of the best performing sections in economy Drug Discovery Disciplines • • • • • • Medicine Physiology/pathology Pharmacology Molecular/cellular biology Automation/robotics Medicinal, analytical,and combinatorial chemistry • Structural and computational chemistries • Computational biology Drug Discovery Program Rationales • Unmet Medical Need • Me Too! - Market - ($$$s) • Drugs in search of indications – Side-effects often lead to new indications • Indications in search of drugs – Mechanism based, hypothesis driven, reductionism Issues in Drug Discovery • • • • • • • Hits and Leads - Is it a “Druggable” target? Resistance Delivery - oral and otherwise Metabolism Solubility, toxicity Patentability …… A Little History of Computer Aided Drug Design • 1960’s - Review target-drug interactions • 1980’s- Automation - high throughput target/drug selection • 1980’s- Databases (information technology) - combinatorial libraries • 1980’s- Fast computers - docking • 1990’s- Faster computers - genome assembly - genomic based target selection • 2000’s- Fast information handling - pharmacogenomics From the Computer Perspective Comparing Growth Rates 40 35 Increase factor 30 Processor performance growth Memory bus speed growth Pixel fill rate growth 25 20 15 10 5 0 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 From the Target Perspective Status - Numbers and Complexity (a) myoglobin (b) hemoglobin (c) lysozyme (d) transfer RNA (e) antibodies (f) viruses (g) actin (h) the nucleosome (i) myosin (j) ribosome Courtesy of David Goodsell, TSRI From the Drug Perspective Combinatorial Libraries • Thousands of variations to a fixed template • Good libraries span large areas of chemical and conformational space - molecular diversity • Diversity in - steric, electrostatic, hydrophobic interactions... • Desire to be as broad as “Merck” compounds from random screening • Computer aided library design is in its infancy Blaney and Martin - Curr. Op. In Chem. Biol. (1997) 1:54-59 Computer-Assisted Drug Design • Computer driven drug discovery • Data driven drug discovery An overview of biomolecules • Living organisms are more ordered than their surroundings. • So the first task is to maintain a separation between inside and outside. • The second task is to spend energy to keep things in order. • The functions of life are to facilitate the acquisition and expenditure of energy. Cell • Cells are the smallest compartments that are ordered and separated from the surroundings. • Note that ordered compartments were difficult to get started de novo, and so have found ways to pass on the apparatus necessary to perpetuate themselves. Tasks of a living cell • Gather energy from surroundings. • Use energy to maintain inside/outside distinction. • Use extra energy to reproduce. • Develop strategies for being efficient at their tasks: developing ways to move around; developing signaling capabilities; developing ways for energy capture; developing ways of reproduction. Molecular means to realize these tasks • Ability to separate inside from outside with lipids • Ability to build three-dimensional molecules that assist their functions, proteins, RNA • Ability to store information for these tasks, part of reproduction also, DNA A simple model of a cell proteins Lipid membrane DNA Lipids • Made of hydrophilic (water loving) molecular fragment connected to hydrophobic fragment. • Spontaneously form sheets (lipid bilayers, membranes) in which all the hydrophilic ends align on the outside, and hydrophobic ends align on the inside. • Creates a very stable separation, not easy to pass through except for water and a few other small atoms/molecules. Lipids Lipid bilayers: Structure Lipid bilayers: Structure Lipid bilayers: Functions Lipid bilayers A simple model of a cell proteins Lipid membrane DNA Proteins: A chain of linked subunits • These subunits are amino acids (also called protein residues for historical reasons). • There are 20 different amino acids with different physical and chemical properties. • The interaction of these properties allows a chain of the amino acids (upto 1000’s long) to fold into a unique, reproducible 3D shape. 20 amino acids • Common back bone • Unique side chain Ala A Alanine Glu E Glutamic Acid Arg R Arginine Amino acid structures Fig. 5.3 Fig. 5.3 Amino acid properties • Polar amino acids: THR, SER, ASN, GLN, TYR, HIS, TRP, CYS • Charged amino acids: ASP, GLU, LYS, ARG, HIS, CYS • Hydrophobic amino acids: VAL, LEU, ILE, PHE, ALA, PRO, GLY, MET, TYR, TRP Representations of proteins • 1-d sequence: Alanine-Tyrosine-Valine= ALA-TYR-VAL= A-Y-V Representations of proteins: 2-d THH HHHHHTLLLH HHHHHGGGLS STTEEEEEEE Representations of proteins: 3-d Protein features • Protein can be stabilized by salt bridges • Protein can be folded to a unique structure due to the existence of disulfide bonds • Protein may function as an enzyme whose active sites are crucial for its function A simple model of a cell proteins Lipid membrane DNA DNA structures DNA packs in the nucleus to form chromosome DNA structure DNA is a sequence too • It has a common back bone, and side chains, though only 4 kinds. • A sequence of these subunits is also specified as a string: ACTTAGGACATTTTAG, which is a simplified representation of a chemical structure. DNA is a sequence too • DNA uses an alphabet of 4 letters (ATCG), i.e. bases. • Long sequences of these 4 letters are linked together to create genes and control information. Information in DNA • DNA encodes proteins: each amino acid can be specified by 3 bases. Ribosome reads a DNA sequence and creates the corresponding protein chain. • GENETIC CODE: 64 mappings of 3 bases to 1 amino acid. Genetic code The gene for myoglobin • • • • • • • • • • ctgcagataa tgaatggcag ctggtcatgg actctggaaa gaaagcttct taggtgctat cttgcgcaat attcatctct acttcggtgc cgtaaagata ctaactaaag ctggttctgc tcaggacatc aattcgatcg gaagatctga ccttaagaaa cgcatgctac gaagcgatca tgacgctcag tcgctgctaa gagaacaaca atgtttgggc ttgattcgac tttcaaacat aaaaacatgg aaagggcatc taaacataag tccatgttct ggtgctatga ctgggttacc acaatggttc taaagttgaa tgttcaaatc ctgaaaactg tgttaccgtg atgaagctga atcccgatca gcattctaga acaaagctct agggttaatg tgtctgaagg gctgacgtcg tcatccggaa aagctgaaat ttaactgccc gctcaaaccg aatacctgga catccaggta cgagctgttc aggtacc BASE COUNT 155 a 108 c 115 g 129 t MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEM KASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAI IHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG Genes and control • The set of all genes required for an organism is the organism’s GENOME. • Human genome has 3,000,000,000 bases divided into 23 linear segments (chromosomes). • A gene has on average 1340 DNA bases, thus specifying a protein of about 447 amino acids. • Humans have about 35,000 genes = 40,000,000 DNA bases = 3% of total DNA in genome. • Humans have another 2,960,000,000 bases for control information. (e.g. when, where, how long, etc...) Genotype and phenotype • Genotype—the genetic sequences associated with an individual organism. • Phenotype—the observable non-sequence features of an individual organism (e.g. color, shape, activity of an enzyme) How do we proceed? In order to obtain insight into the ways in which genes and gene products function: • Analyze DNA and protein sequences to search clues for structure, function and control – sequence analysis • Analyze structures to search clues for sequences, function and control – structural analysis • Understand how sequences and structures leads to functions – functional analysis But what are functions of genes? • Signal transduction: sensing a physical signal and turning into a chemical signal • Structural support: creating the shape and of a cell or set of cells • Enzymatic catalysis: accelerating chemical reactions otherwise too slow to be useful for living things • Transport: getting things in and out of a compartment. But what are functions of genes? • Movement: contracting in order to pull things together or push things apart • Transcription control: deciding when other genes should be turned on/off • Trafficking: affecting where different elements end up inside a cell. Evolution is the key • Common descent of organisms implies that they will share many basic approaches • Development of new phenotypes in response to environmental pressure can lead to specialized approaches • More recent divergence implies more shared approaches between species • The important thing is which is shared and which is not unshared. This is also important for drug discovery in biomedicine. Seeing is believing: Computer Graphics Je-2147/HIV Protease Complex HIV Integrase The Small Ribosomal Subunit The Large Ribosomal Subunit