Survey
* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
DNA vaccination wikipedia , lookup
Plant disease resistance wikipedia , lookup
Duffy antigen system wikipedia , lookup
Anti-nuclear antibody wikipedia , lookup
Immunocontraception wikipedia , lookup
Cancer immunotherapy wikipedia , lookup
Polyclonal B cell response wikipedia , lookup
Immunosuppressive drug wikipedia , lookup
Molecular mimicry wikipedia , lookup
B-Cell Epitopes Chapter 10 Claus Lundegaard Antibodies Antibodies. What are they? • Virtually any substance can elicit an antibody response. • Clear extra cellular pathogens • neutralizing antibodies • Antibody repertoire • > 11 10 in humans • How is this possible? • ~ 30.000 genes in the humans genome! • Immunoglobulin gene rearrangement Antibody Effect. Neutralizing Antibodies Virus or Toxin Neutralizing Antibodies Inhibit cellular infection Clear pathogen infection Antibody - Antigen interaction Antigen Fab (fragment antigen binding) Epitope Paratope Antibody B-Cells. How are they made? Stem Cell Precurser Blymphocytes Gene rearrangements B-lymphocytes each displaying a unique B-cell receptor Gene Shuffling Number of gene segments The 12/23 rule of recombination { recombination signal sequence (RSS) Only combined 12 RSS to 23 RSS Mechanism of gene rearrangement RAG proteins (recombinationactivating genes) Addition of P and N nucleotides Antibody variable regions, CDR’s (Complementarity-determining regions) CDR Regions Variable regions Alpha-carbon trace of the structure of the heavy chain and light chain variable regions of a typical antibody. The framework regions of both chains are shown in grey whilst the complementarity determining regions (CDRs) are coloured individually, i.e. CDR = complementarity determining region Heavy chain CDR 1 = Light blue CDR 2 = Cerise CDR 3 = Yellow Light Chain CDR 1 = Red CDR 2 = Green CDR 3 = Blue QuickTime™ and a TIFF (Uncompressed) decompressor are needed to see this picture. http://212.219.234.139/html/anti_alpha.html Identifying CDR regions • The Kabat definition is based on sequence variability and is the most commonly used • The Chothia definition is based on the location of the structural loop regions • The AbM definition is a compromise between the two used by Oxford Molecular's AbM antibody modelling software • The contact definition has been recently introduced by us and is based on an analysis of the available complex crystal structures. Identification of CDR’s (II) CDR-H1 Start Approx residue 26 (always 4 after a Cys) [Chothia / AbM defintion]; Kabat definition starts 5 residues later Residues before always Cys-XXX-XXX-XXX Residues after always a Trp. Typically Trp-Val, but also, Trp-Ile, Trp-Ala Length 10 to 12 residues [AbM definition]; Chothia definition excludes the last 4 residues CDR-H2 Start always 15 residues after the end of Kabat / AbM definition) of CDR-H1 Residues before typically Leu-Glu-Trp-Ile-Gly, but a number of variations Residues after Lys/Arg-Leu/Ile/Val/Phe/Thr/Ala-Thr/Ser/Ile/Ala Length Kabat definition 16 to 19 residues; AbM (and recent Chothia) definition ends 7 residues earlier CDR-H3 Start always 33 residues after end of CDR-H2 (always 2 after a Cys) Residues before always Cys-XXX-XXX (typically Cys-Ala-Arg) Residues after always Trp-Gly-XXX-Gly Length 3 to 25(!) residues Example >BU02A02.1 GVQCEVHLLESGGGLVQPGGSLRLSCAASGFTF YSYAMSWVRQAPGKGLEWVSANSGSGGSTY YADSVRGRFTISRDNSKNTLYLQMNSLSAEDT AVYFCAKAPGYYYYYGMDVWGQGTTVTVSSG KNGHSRAFV 15 amino acids after end of CDR1 Somatic hypermutations B-Cell Activation (Proliferation depends on affinity) No Affinity Low Affinity No Affinity Somatic Hypermutations High Affinity Plasma cells Memory B-cells B-Cell Activation T Helper Cell TCR B Cell Class II MHC Bound Peptide Cartoon by Eric Reits Controversial issues • Is the 11/23 rule always obeyed? • Can you have multiple D genes? • Can D genes be inserted backwards? • I.e can both D and the inverted D genes be used? • Does V, D and J palindrom segments exits? What did we find? • Issue of next talk