Survey
* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Protein (nutrient) wikipedia , lookup
Protein moonlighting wikipedia , lookup
Extracellular matrix wikipedia , lookup
Tissue engineering wikipedia , lookup
Cellular differentiation wikipedia , lookup
Cell culture wikipedia , lookup
Protein phosphorylation wikipedia , lookup
Organ-on-a-chip wikipedia , lookup
Plant Cell Physiol. 40(1): 53-59 (1999) JSPP © 1999 Characterization of Cytosolic Cyclophilin from Guard Cells of Viciafaba L. Toshinori Kinoshita and Ken-ichiro Shimazaki Department of Biology, Faculty of Science, Kyushu University, Ropponmatsu, Fukuoka, 810-8560 Japan The effect of immunosuppressant cyclosporin A (CsA) on inward-rectifying K+-channels and biochemical analysis have indicated the presence of cyclophilin in guard cells of Vicia faba. In this study, we identified a full-length cDNA sequence, vcCyP, encoding cyclophilin (CyP), a peptidyl-prolyl cis-trans isomerase of guard cell protoplasts (GCPs) from Viciafaba L. The deduced amino acid sequence revealed that vcCyP contained 171 amino acid residues and exhibited a strong similarity to previously described cytosolic CyP isoforms from other plants. vcCyP had seven extra amino acid residues, which is a characteristic of the cytosolic form of plant CyPs. A complex of recombinant vcCyP and CsA inhibited the phosphatase activity of bovine calcineurin, a type 2B protein phosphatase, with a half-inhibitory concentration of 0.2 //M. Protein phosphatase activity was measured in the cytosolic fraction of GCPs using a 32P-labeled myelin basic protein (32P-MBP) and the activity was increased by a physiological concentration of Ca2+ (1/*M). This Ca2+-stimulated phosphatase activity was inhibited by CsA, suggesting the presence of both cytosolic CyP and calcineurin-like protein phosphatase in guard cells. Northern blot analysis showed that the transcription level of vcCyP was much higher in GCPs than in root and leaf tissues of Vicia. This property of CyP has led to the extensive study towards elucidating the cellular function of calcineurin in animals. CyPs have peptidyl-prolyl cis-trans isomerase activity that is inhibited by CsA and catalyze refolding of some denatured proteins indicating that CyPs are involved in protein folding and maturation in vivo (Gething and Sambrook 1992). In support of this hypothesis, evidence has been presented that a CyP homologue, nina A, in Drosophila is required for proper maturation of a subset of eye-specific retina proteins (Schneuwly et al. 1989). In higher plants, the presence of cytosolic, chloroplast and mitochondrial forms of CyPs has been reported, and cDNAs for CyPs have been isolated from several higher plants. The expression of CyPs is affected by environmental and stress conditions (Lippuner et al. 1994, Luan et al. 1994a, b, Marivet et al. 1994, 1995). Very recently, Arabidopsis CyPs were found to interact with both VirD2 and VirE2 proteins, that have important functions in integrating the T-DNA into host plant cells, in the T complex of Agrobacterium tumefaciens (Deng et al. 1998). However, very little is known about the physiological role of CyPs in higher plants. Stomatal pores surrounded by guard cells regulate exchanges of CO2 and water between leaves and the atmosphere (Zeiger 1983, Assmann 1993). Since guard cells respond to various environmental stimuli such as light, humidity, CO2, Ca 2+ , and plant hormones, guard cells have been extensively investigated as an excellent model system to elucidate the mechanisms for perception and transduction of signals. Opening of stomata is mediated by an accumulation of K+ through inward-rectifying K + channels in the plasma membranes of guard cells, and K + accumulation is driven by an inside-negative electrical potential across the plasma membrane (Assmann et al. 1985, Shimazaki et al. 1986, Hedrich and Schroeder 1989). Inward-rectifying K+ channels have been shown to be inhibited by cytoplasmic Ca 2+ (Schroeder and Hagiwara 1989), and this Ca2+-dependent inhibition of the K + channels is nullified by immunosuppressant CsA in guard cell protoplasts (GCPs) from Vicia faba L. (Luan et al. 1993). Endogenous CyP in guard cells forms a complex with CsA, which may be involved in Ca2+-dependent regulation of inward-rectifying K + channels by inhibiting the calcineurin-like protein phosphatase. Calcineurin-like phosphatase activity has been found in extracts from Vicia epidermal peels in which guard cells are the only intact cell type (Luan et al. 1993). However, CyPs, intracellular receptors for CsA, in guard cells have not been further Key words: Calcineurin (EC 3.1.3.16) — Cyclophilin (EC 5.2.1.8) — Cyclosporin A — Guard cell — Stomata — Viciafaba L. Cyclophilin (CyP) (EC 5.2.1.8) is an abundant, highly conserved protein present in various organisms (Schreiber 1991). CyP was first identified as a high affinity binding protein for the immunosuppressive drug cyclosporin A (CsA) (Handchumacher et al. 1984). The CyP-CsA complex suppresses the immune response through inhibition of a Ca2+-dependent phosphoprotein phosphatase, calcineurin, a type 2B protein phosphatase (EC 3.1.3.16) (Haendler et al. 1987, Liu et al. 1991, Alsh et al. 1992). Abbreviations: CsA, cyclosporin A; CyP, cyclophilin; EGTA, l,2-bis(2-aminophenoxy)ethylene N.N.N'.N'-tetiancetic acid; GCPs, guard cell protoplasts; GST, glutathione S-transferase; MCPs, mesophyll cell protoplasts; OA, okadaic acid; 32 P-MBP, 32P-labeled myelin basic protein. The nucleotide sequence reported in this paper has been submitted to the DDBJ, EMBL, GenBank under accession number ABO 12947. 53 Cytosolic cyclophilin in guard cells 54 characterized. In this study, we determined a full-length cDNA sequence encoding cytosolic CyP of guard cells from Vicia faba L. and showed that the complex of cytosolic CyP and CsA inhibited the activities of both animal calcineurin and Ca 2+ -dependent calcineurin-like protein phosphatase in guard cells. We also showed that the transcription level of the CyP is much higher in guard cells than in other tissues of the Vicia plant. Materials and Methods Plant materials and isolation of protoplasts—Vicia faba L. (cv. Ryosai Issun) was cultured hydroponically in a green house (Shimazaki et al. 1992). GCPs were isolated enzymatically from the lower epidermis of 4- to 6-week-old leaves of Vicia faba as reported previously (Gotow et al. 1984). Mesophyll cell protoplasts (MCPs) were prepared according to a method described previously (Shimazaki et al. 1982). Construction of the first-strand cDNA and circular cDNA —RNA was extracted from GCPs of Vicia faba with acid guanidinium thiocyanate-phenol-chloroform (ISOGEN; Nippon Gene, Tokyo, Japan) according to the method reported by Chomczynski and Sacchi (1987). The first-strand cDNA (25 ft\) was synthesized from total RNA (10 fi%) of GCPs by AMV reverse transcriptase (Takara, Tokyo, Japan) using Oligo(dT)i2-i8 as a primer, and was used as a template for PCR. The circular cDNA (25 ftl) was made from an aliquot of the first-strand cDNA (12.5 fA) using two distinct enzymes. The 5' terminus of the first-strand cDNA was phosphorylated with T4 polynucleotide kinase (Takara, Tokyo, Japan) for 30 min at 37°C to increase the efficiency of self-ligation, and the resultant 5'-phosphate of the first-strand cDNA was self-ligated with T4 RNA ligase (Takara, Tokyo, Japan) for 16 h at 14°C. The circular cDNA was used for inverse PCR. Isolation of PCR fragment and DNA sequencing—All PCR procedures were carried out using a recombinant Taq DNA polymerase (Takara, Tokyo, Japan) under normal conditions (Maniatis et al. 1982). cDNA fragments of CyP were amplified from the first-strand cDNA using degenerate oligonucleotide primers (5-GGIGGIGARWSIATHTAYGG-3' and 5'-AARCAYGTNGTNTTYGAR-3'). PCR was carried out using 1.0/il of the first-strand cDNA obtained as described above. Two primers (5ATTCCTGGACCGGTGTGCTT-3' and 5'-CGGAACCAACGGATCTCAGT-3') oriented in the reverse direction were designed from the PCR-amplified fragment, and were used for inverse PCR. The inverse PCR was carried out using 2.0 fA of the circular cDNA obtained as described above. Two primers (5'-GTTCTCGTCAGCGAACTTGG-3' and 5-AGACTGACTGGCTCGACGG-3) oriented in the reverse direction were designed from the PCRamplified fragment and were used for the nested PCR. Nested PCR was carried out using 1.0 fA of the product of inverse PCR. PCR products were cloned into a pCRII vector (Invitrogen, San Diego, CA, U.S.A.). Sequences were determined from both strands of the cDNA using A.L.F. red DNA sequencer (Pharmacia Biotech, Tokyo, Japan). Nucleotide and amino acid sequences were analyzed using the GENETYX software system (Software Development Co., Tokyo, Japan). Expression of recombinant VcCyP protein in Escherichia coli—The cDNA fragment encoding the mature protein of the VcCyP (47-562 bp) was amplified by PCR and cloned in frame with glutathione S-transferase (GST) into the pGEX-2T plasmid vector (Pharmacia Biotech, Tokyo, Japan). E. coli (JM109) cells transformed with the plasmid having the fusion protein construct were grown at 30°C in 2xYTA medium. When the culture showed a turbidity of A6Oonm=0.8, isopropyl-6-D-thiogalactopyranoside at a final concentration of 0.1 mM was added to induce recombinant vcCyP. Cells were harvested 4 h after the induction and resuspended in PBS buffer. Purification of the recombinant protein was performed according to the method of Bulk and RediPack GST purification modules (Pharmacia Biotech, Tokyo, Japan). Calcineurin assay—Activity of calcineurin was determined using 32P-labeled myelin basic protein (32P-MBP) as a substrate. MBP was phosphorylated with [y-32P]ATP by agarose-conjugated p44 MAP kinase (ERK1, UBI, New York, NY, U.S.A.), and the phosphorylated product was prepared as reported previously (Chajry et al. 1996). The assay mixture (50/ul) contained 50 mM Tris-HCl (pH 7.5), 0.2 mM CaCl2, 6 mM MgCl2, 0.5 mM dithiothreitol, 100//gmP 1 bovine serum albumin, 0.1/uM calmodulin from bovine (Sigma), 0.1 ftM calcineurin from bovine (Boehringer Mannheim, Tokyo, Japan), 2.5 fig 32P-MBP (6,000 cpm /Ug~'), and various concentrations of the recombinant vcCyP and CsA complex. The recombinant vcCyP protein and CsA were premixed at a molar ratio of 1 : 5 and incubated at 4°C for 2 h before the assay. The reaction was allowed to proceed at 30°C for 10 min and was terminated by the addition of 200 fA of 20% trichloroacetic acid to the mixture. After centrifugation at 10,000 x g for 10 min at 4°C, the released 32P; in the supernatant was determined on a Beckman LS65O0 system. Protein phosphatase assay in guard cell extract—A cytosolic fraction of GCPs was obtained according to the previous method with slight modifications (Kinoshita et al. 1993). Protoplast suspensions (1 mgmP 1 protein) were mixed with the same volume of 100 mM HEPES-KOH (pH 7.4), 4 mM l,2-bis(2aminophenoxy)ethylene N,N,N,./V-tetraacetic acid (EGTA), 2 mM dithiothreitol, 200/ugml~1 bovine serum albumin, 20 fig ml" 1 leupeptin, 1 mM phenylmethylsulfonyl fluoride. After keeping these suspensions on ice for 2 min, the protoplasts were ruptured using a Teflon hand-held homogenizer. Homogenized protoplasts were centrifuged at 10,000 x g for 10 min. The resulting supernatant as a cytosolic fraction was used for protein phosphatase assay. The supernatants (20 /il) were preincubated in the presence and absence of okadaic acid (OA), Ca 2+ , and CsA at different concentrations for 10 min at 24° C, and then dephosphorylation was started by addition of 20(A of 0.5 mgml" 1 32 PMBP (6,000 cpm fig'1). Ca 2+ concentration was calculated using the dissociation constants of EGTA chelates of Ca 2+ and Mg 2+ (Sillen and Martell 1971). The reaction and determination of activity were the same as described above. Northern blot analysis—Northern blot hybridization was performed according to the standard procedure of a Digoxigenin Luminescent Detection Kit (Boehringer Mannheim, Tokyo, Japan). Total RNA was extracted from GCPs, MCPs, leaves and roots of Vicia faba with ISOGEN (Nippon Gene, Tokyo, Japan). A cDNA from 14 bp to 856 bp of VcCyP was obtained by PCR using a cDNA-containing adapter primer and was used as a probe. The cDNA-containing adapter primer was synthesized from the mRNA of GCPs using Oligo(dT)-containing adapter primer (GIBCO BRL, MD, U.S.A.). Results Isolation of cDNA fragments of CyP—We designed two degenerate oligonucleotide primers from conserved Cytosolic cyclophilin in guard cells amino acid sequences (GGESIYG and KHVVFG) of CyPs (Fig. 1). These primers were used for amplification of a first-strand cDNA template which was made from Vicia GCPs, by PCR. We obtained PCR-amplified fragments of 170 bp in length, and sequenced twenty of these products. All fragments had identical nucleotide sequences and contained a CyP-related sequence. Determination of a full-length sequence of CyP by inverse PCR—A full-length cDNA could not be isolated by 55 screening of the AZAPII cDNA library from Vicia GCPs with the amplified fragment of 170 bp as a probe. Thus, a circular cDNA was made from the first strand cDNA, and a cDNA encoding a 5'- and 3'-region of CyP was obtained from the circular cDNA by the inverse PCR (see Methods). Four primers in the reverse direction of usual orientation were designed on the basis of a 170 bp PCRamplified fragment for the inverse and nested PCRs (Fig. 1). We obtained a PCR product of 765 bp in length. TTTTACCCATTACGATCTGATTCAACCACTTCTCAAACCCTAAGCCATGTCAAACCCCAA ---------------------M S N P K 60 5 AGTTTTCTTCGATATGACCGTCGGCGGCCAAAACGCTGGACGCATCATCTTTGAGCTTTT V F F D M T V G G Q N A G R I I F E L F 120 25 TGCCGATGTCACTCCCAGAACCGCTGAGAATTTCCGTGCTCTCTGCACCGGCGAGAAAGG A D V T P R T A E N F R A L C T G E K G 180 45 AGTCGGTCGTAGCGGCAAGCCACTCCACTTCAAGGGATCCTCCTTCCACCGTGTGATCCC V G R S G K P L H F K G S S F H R V I P . 240 65 TAACTTCATGTGCCAGGGAGGTGACTTCACCGCCGGAAACGGCACCGGAGGAGAATCGAT N F M C Q G G D F T A G N G T |G G E S I 300 85 CTACGGTTCCAAGTTCGCTGACGAGAACTTCATCAAGAAGCACACCGGTCCAGGAATCTT Y G| S K F A D E N F I K K H T G P G I L 360 105 ATCCATGGCGAACGCTGGACCCGGAACCAACGGATCTCAGTTCTTCATCTGCACTGCCAA S M A N A G P G T N G S Q F F I C T A K 420 125 GACTGACTGGCTCGACGGGAAACACGTCGTGTTCGGTCAGGTTGTCGATGGATTGAACGT T D W L D G |K H V V F (f| Q V V D G L N V 480 145 TGTGAGGGATATTGAGAAGGTTGGATCTGGCTCTGGCAAGACCTCTAAGCCTGTTGTGAT V R D I E K V G S G S G K T S K P V V I 540 165 CGCCAATTGTGGACAACTGTAGATCATACTGTTTTGGCGTTTTTTAAACTGGTGGCTCTG A N C G Q L * 600 171 ATTTTTAATTTGATCTCAAATTCTAGTTGTGTTTTTCTGATTCGCGTCGTTTTACTTTTC 660 TCGTGTTAGGGTTTGTGGTTGTGGTGCTCTATGGATCCTATTGAACCCTCCCTTTTTAAT 720 TTTCTGTTACTGTTACTATCCGTATGAAATTAGTAGTTGAGTGAGTTGAGTCTTGTTATG 780 CTGAACATTAAAATGATGAGCTACCTTCAATAAATTAGATTTTATTCCTAAAAAAAAAAA 840 AAAAAAAAAAAAAAAA 856 Fig. 1 Nucleotide (upper) and deduced amino acid sequence (lower) of vcCyP. In frame termination codon within the 5'-untranslated sequence is double underlined. Asterisk shows termination codon. The amino acid sequences corresponding to degenerate oligonucleotide primers and nucleotide sequences corresponding to primers for the inverse and nested PCRs are boxed and underlined, respectively. Nucleotide sequences corresponding to primers for PCR using cDNA-adapter primer (see Methods) are dash underlined. Within the 3'-untranslated sequence, a direct repeat is indicated by bold letters. 56 Cytosolic cyclophilin in guard cells Sequence analysis revealed that the 765 bp fragment contained a 5'- and 3'-region of CyP. From these sequences, vcCyP (cDNA sequence for cytosolic CyP from Viciafaba) was determined (Fig. 1). vcCyP was 856 bp in length and contained a 513 bp open reading frame, encoding a putative polypeptide of 171 amino acids with a predicted molecular mass of 18,065. The deduced amino acid sequence encoded by vcCyP had a strong similarity to the previously described cytosolic CyP isoforms of other plants. vcCyP is closely related to cytosolic CyPs from Phaseolus vulgaris, Digitalis lanata, and Arabidopsis thaliana (84-89% identity). However, VcCyP shares only 70% and 58% se- vcCyP P. vulgaris D. lanata A. thaliana Human pCyP B quence identities respectively with human cytosolic CyP and pCyP B, a chloroplast-localized CyP of Viciafaba L. (Fig. 2). VcCyP contained a seven amino acid insertion (position 48-54) that appears to be a characteristic of plant cytosolic CyP (Lippuner et al. 1994, Buchholz et al. 1994). On the basis of sequence similarities we conclude that vcCyP encodes a cytosolic form of CyP in guard cells. Inhibition of calcineurin by vcCyP and CsA complex—We expressed GST-vcCyP fusion protein in E. coli cells and purified recombinant vcCyP. Purified recombinant vcCyP showed a single band (19 kDa) on Coomassie Brilliant Blue (CBB)-stained SDS-polyacrylamide gel 1:-MSNPKVFFDMTVGGQNAGRIIFELFADVTPRTAENFRALCTGEK • -L • • • AT • < T . .V.. PC . .VM. Y V.K. 1:MAT Y. . .VM.i Y • • T • • E • • • KV.K 1:-.V..T... I A . D . E P L . .VS • V S . . ...KV.K... S. .EK VIG..G.AV.K.V...KT.S..AK 78:AKVTS.I...IEI..ES ** * * *** ** * ** vcCyP P. vulgaris 4 5 rGVGRSGKPLHFKGSSFHRVIPNFMCQGGDFTAGNGTGGESIYGSK 45: V I A. U m 4 j t a « « J ! \ l « * « « « x « t « .£ cz/icz Ccz rx O • • _L • X * y • Human pCyP B 45: .F. 123:.Y.* * A • • • • • • \ 3• • • • • • • • • • • • • • • • • • • • • A .• • • • • . ] . • • • • • • • • • • & • • • • • • • • • • • • • • • • • • • * • • • Y. ..C...I..G.. RH K....E. YQ..F...I I E V ** *** ** ** ****** ***** **** * vcCyP 90:FADENFIKKHTGPGILSMANAGPGTNGSQFFICTAKTDWLDGKHV P. vulgaris 90: V T..E D. lanata 90: V E..S A • tho.HB.ns 9 1 t . K » . • • • • • • • • • • • • • • • • • • A N • • • • • • • • • • E * * o « « * * « « * Hu.ni3.ri pCyP B oo5»E«»*»»Li«»»»»»*« •••••••£<• ••••••••••••£«••••••• 1 6 1 : . E . . S . D L . . V . . .V * vcCyP P. vulgaris D. lanata A. thaliana Human pCyP B ** * ** *** * * * * * * * N ********** VP.P NR. . * *** ** 135 : VFGQWDGLNWRDIEKVGSGSGKTSKPWIANCGQL 135: E..D..K AR. .A. .D. . . .S 135: E.MD. . .A Q. . . .A D. . .IC 136: E D. .R D.. .IS 128: . . .K.KE.M. I.EAM.RF. .RN KIT. .D E 206:...H.IE..D..KQL.SQETSKLDN.PKKPCKIAKSGELPLDG *** * * • * * Fig. 2 Sequence alignment of CyP protein sequences. The amino acid sequence of vcCyP deduced from the corresponding cDNA sequence is aligned with CyPs of Phaseolus vulgaris (X74403), Digitalis lanata (Y0832O), ROC3 from Arabidopsis thaliana (Chou and Gasser 1997), human (P05092), and pCyP B from Viciafaba L. (Luan et al. 1994b). Dots indicate amino acids which are identical to the vcCyP sequence, and dashes indicate gaps introduced to allow for optimal alignment of the sequences. Asterisks show those positions where all six sequences are identical. A computer-assisted homology search of vcCyP was performed with a DDBJ homology system using the program BLAST version 1.4.9 (Altschul et al. 1990). Cytosolic cyclophilin in guard cells (Fig. 3A). A complex of recombinant vcCyP and immunosuppressant CsA was produced by preincubation for a sufficient time, and the complex inhibited bovine calcineurin activity at a half-inhibitory concentration of 0.2 fjM (Fig. 3B). This value is comparable to that in inhibition of calcineurin by the complexes of CsA with CyPs of mammalians and plants (Haendler et al. 1987, Liu et al. 1991, Alsh et al. 1992, Luan et al. 1994b). The recombinant vcCyP protein and CsA alone had no effect on the calcineurin activity. Inhibition of Ca2*-dependent protein phosphatase activity in guard cells by CsA—Protein phosphatase activity was determined using 32P-MBP as a substrate in the cytosolic extract from Vicia GCPs. We tested the effect of OA, an inhibitor of type 1 and type 2A protein phosphatase, on this phosphatase activity. The phosphatase activity was inhibited by OA at 0.1 /xM and the extent of inhibition was the same at a higher concentration of OA (Fig.4A). The OA-sensitive protein phosphatase activity comprised 65% of the total phosphatase activity in this experimental condition. The phosphatase activity was increased by a physiological concentration of Ca 2+ (1 fiM) in the presence of OA, and this Ca2+-stimulated, OAinsensitive phosphatase activity was suppressed by CsA (Fig.4B). This indicates that a cytosolic fraction of GCPs contains Ca2+-dependent calcineurin-like protein phosphatase, and that endogenous cytosolic CyP has the ability to inhibit calcineurin-like protein phosphatase activity in the presence of CsA. CsA had no effect on the phospha- 94 67 43 «. ""ITT.' B 12 ° T 1 3 LI § 2 o ol control) 1 kDa 20.1 14.4 200 T ! fso 1 (0 ta 3% li 1 L . 8 1 i 6 01" 40; '. T T ri i—i i i • ; © o; 0 •: 0 0.00 I •m [ i 20-s I! g 100 0.01 0.1 I i CsA - - + + Fig. 4 Protein phosphatase activity in guard cells. (A) OAinhibition of protein phosphatase activity in cytosolic fraction of GCPs. Phosphatase activity was determined using 32P-MBP as a substrate in the presence and absence of different concentrations of OA. Relative activity is presented as a percentage of control activity. Vertical bars represent standard errors of three separate experiments. (B) Effect of Ca 2+ and CsA on the OA-insensitive protein phosphatase activity. Reaction mixture contained OA at 1 ftM. +Ca 2 + , 1 fiM; +CsA, 5 ftM. Other conditions were the same as in (A). tase activity without Ca 2+ . Northern blot analysis of vcCyP—To determine the transcription level of vcCyP in mature plants, a Northern blot analysis of total RNA from GCPs, roots, MCPs and leaves was conducted with cDNA of vcCyP as a probe. As shown in Figure 5, VcCyP hybridized to a single mRNA band of 850 bp in length in each lane. The transcription level of vcCyP was much higher in GCPs than in roots and T r .- i . j I" 60 30 B 100 » [ i i~ 14 I ° 2 8 ° 850 b p i i 1 j 1 { i | ir 0 0.05 0.1 0.2 0.3 0.4 0.5 1.0 %. [vcOyP - CsA| iM 'i •& u im GCP Root MCP Leaf Fig. 3 (A) Purification of recombinant vcCyP protein from E. coli cells. The over-expression of GST fusion protein in E. coli (43 kDa, lane 2), 0.5 /Jg of purified recombinant vcCyP protein Fig. 5 Northern blot hybridized with vcCyP cDNA clone. Each (19 kDa, lane 3), and molecular mass marker proteins (lane 1) lane contained an equal amount (20^g) of total RNA isolated were analyzed by SDS-PAGE and detected by CBB staining. from GCPs, roots, MCPs and leaves. (A), blot hybridized with a (B) Inhibition of calcineurin activity by a CyP-CsA complex. 842 bp of the vcCyP cDNA clone. (B) shows the amount of RNA 32 Calcineurin activity was determined using P-MBP as a subin each lane that has been transferred onto membrane. The gel strate in the presence and absence of different concentrations of was stained with ethidium bromide, and was visualized with a UV the complex of recombinant vcCyP and CsA. vcCyP and CsA illuminator. (C) shows the relative amount of transcript. Level of individually added to the reaction mixture at 1 ftM and 5/^M, re- transcript was determined densitometrically. Relative values are spectively. Relative activity is presented as a percentage of control presented as the percentages of the transcript level in GCPs. Exactivity. Vertical bars represent standard errors of three sepaperiments repeated two times on different occasions gave similar rate experiments. results. Cytosolic cyclophilin in guard cells 58 leaves. The amount of vcCyP mRNA in GCPs was approximately five- and fifteen-fold larger than those in root and leaf tissues, respectively (Fig. 5c). The transcription of pCyP B, a chloroplast-localized CyP with a molecular mass of 21 kDa in Vicia leaf, is induced by heat shock at 37°C for 4 h (Luan et al. 1994 b). The same heat treatment had no effect on the transcription of vcCyP in Vicia leaves (data not shown). Discussion In this study, we determined a full-length cDNA sequence, vcCyP, encoding CyP in guard cells of Vicia faba L. Since all twenty CyP fragments, obtained by PCR using degenerate oligonucleotide primers, contained identical sequences, vcCyP is most likely to be the major CyP in guard cells. The primary sequence revealed that vcCyP encoded the cytosolic form of CyP in guard cells, and the deduced molecular mass of putative protein was 18 kDa. Previous studies using the CsA affinity matrix have shown that CyPs, with molecular masses of 18 and 21 kDa proteins, are present in the leaf extracts of Vicia faba L. (Luan et al. 1993, 1994a, 1994b). The vcCyP identified in this study in guard cells is very similar to the 18 kDa CyP found biochemically in Vicia leaf tissue. By contrast, the 21 kDa CyP in Vicia leaf tissue is localized in chloroplasts, and was induced by heat shock (Luan et al. 1994b). To isolate the 5 - and 3'-regions of CyP, we carried out the inverse PCR using the circular first-strand cDNA since our cDNA library from Vicia GCPs had no full-length cDNA of CyP. In general, both 5'- and 3'-rapid amplification of cDNA ends are needed to isolate the 5'- and.3regions of a cDNA fragment. However, the inverse PCR made it possible to obtain both 5'- and 3'-regions of cDNA at the same time, and the circular cDNA could easily be made from an aliquot of the first-strand cDNA. This method is convenient and useful for cells and tissues that are difficult to isolate in sufficient amounts such as guard cells. Inward-rectifying K + channels have been shown to act as a major pathway for K + uptake during stomatal opening and can be inhibited by cytoplasmic Ca 2+ (Schroeder and Hagiwara 1989). This Ca 2+ -dependent inhibition of the K + channels is abolished by immunosuppressant CsA in GCPs from Vicia faba L. (Luan et al. 1993), indicating that endogenous CyP in guard cells forms a complex with CsA and the complex inhibits inward-rectifying K + channels by inhibiting the calcineurin-like protein phosphatase. We first investigated an inhibitory effect of the complex on calcineurin activity in vitro (Fig. 3). Recombinant vcCyP was generated in E. coli as a fusion protein of GSTvcCyP using an isolated cDNA fragment encoding a mature protein of vcCyP, and purified. The complex of recombinant vcCyP and CsA was shown to inhibit animal calcineurin (Fig. 3). Calcineurin-like activity in epidermal guard cell extract has been found in the presence of 1 mM Ca 2+ (Luan et al. 1993). We confirmed the calcineurinlike activity in guard cells at a physiological concentration of Ca 2+ at 1 jiM in this study. This Ca2+-stimulated phosphatase activity was suppressed by the sole addition of CsA to the cytosolic fraction of GCPs, indicating that GCPs contain cytosolic CyP and the complex of endogenous CyP and exogenous CsA inhibits the calcineurinlike phosphatase activity in guard cells (Fig. 4). A transcript of cytosolic CyP was distributed in mesophyll cells, guard cells and root cells. However, the transcript was found in a much larger amount in guard cells than in root and mesophyll cells (Fig. 5). The significantly higher amount of the transcript of cytosolic CyP in GCPs is due possibly to the induction of the transcript during the isolation procedure of GCPs by cellulolytic enzymes under a high osmotic pressure, because various types of stress treatments including heat, cold, salts, chemical and wounding treatments induce the gene expression of CyPs (Lippuner et al. 1994, Luan et al. 1994a, b, Marivet et al. 1994, 1995). However, this may not be the case. The amount of vcCyP transcription products was similar in MCPs and leaf (Fig. 5) although MCPs were isolated with cellulase under high mannitol concentration. In general, a large amount of CyP mRNA is found in developing and young tissues of plants (Marivet et al. 1994, 1995). The much higher content of CyP mRNA in guard cells may be related to protein degradation and synthesis that proceed very actively in these cells, and that the CyP acts as a chaperone-like molecule in the folding and maturation of proteins synthesized de novo. Interestingly, Fukuda et al. (1998) have found that microtubules in mature guard cells increase in number and orient in a radial manner in the daytime and decompose from evening to midnight, andthey suggested that these diurnal dynamic changes are similar to the typical pattern observed in the development and differentiation of immature guard cells. Furthermore, guard cells seem to have a higher activity of protein synthesis than mesophyll cells in the yellow leaves in particular, because the photosynthetic electron transport system in guard cells remains active in falling leaves of Ginkgo biloba even if the mesophyll counterpart has lost its chlorophyll (Zeiger and Schwartz 1982). From these observations, we conclude that vcCyP encodes the major type of cytosolic CyP in guard cells and that CyP can inhibit both animal calcineurin and plant calcineurin-like protein phosphatase in the presence of CsA. This should help elucidate the functional role of calcineurin, a type 2B protein phosphatase, using the immunosuppressant CsA in guard cells, although the physiological role of CyPs in plant cells remains to be clarified. Cytosolic cyclophilin in guard cells We thank Drs. J. Iwashita and K. Kusumi, Kyushu University, for their technical advice on the phosphatase assay and Northern blot analysis. This work was supported in part by a grant from the Ministry of Education, Science, Sports and Culture of Japan, No. 10740371 to T.K. and a Grant-in-Aid for Scientific Research Priority Areas (No. 10170224) to K.S. References Alsh, C.T., Zydowsky, L.D. and Mckeon, F.D. (1992) Cyclosporin-A, the cyclophilin class of peptidylprolyl isomerases, and blockade of T-cell signal transduction. J. Biol. Chem. 167: 13115-13118. Altschul, S.F., Gish, W., Miller, W., Myers, E.W. and Lipman, D.J. (1990) Basic local alignment search tool. J. Mol. Biol. 215: 403-410. Assmann, S.M. (1993) Signal transduction in guard cells. Annu. Rev. Cell Biol. 9: 345-375. Assmann, S.M., Simoncini, L. and Schroeder, J.I. (1985) Blue light activates electrogenic ion pumping in guard cell protoplasts of Viciafaba L. Nature 318: 285-287. Buchholz, W.G., Harris-Haller, L., DeRose, R.T. and Hall, T.C. (1994) Cyclophilins are encoded by a small gene family in rice. Plant Mol. Biol. 25: 837-843. Chajry, N., Martin, P-M., Cochet, C. and Berthois, Y. (1996) Regulation of p42 mitogen-activated-protein kinase activity by protein phosphatase 2A under conditions of growth inhibition by epidermal growth factor in A431 cells. Eur. J. Biochem. 235: 97-102. Chomczynski, P. and Sacchi, N. (1987) Single-step method of RNA isolation by acid guanidinium thiocyanate-phenol-chloroform extraction. Anal. Biochem. 162: 156-159. Chou, I.T. and Gasser, C.S. (1997) Characterization of the cyclophilin gene family of Arabidopsis thaliana and phylogenetic analysis of known cyclophilin proteins. Plant Mol. Biol. 35: 873-892. Deng, W., Chen, L., Wood, D.W., Metacalfe, T., Liang, X., Gordon, M.P., Comai, L. and Nester, E.W. (1998) Agrobacterium VirD2 protein interacts with plant host cyclophilins. Proc. Nail. Acad. Sci. USA 95: 7040-7045. Fukuda, M., Hasezawa, S., Asai, N., Nakajima, N. and Kondo, N. (1998) Dynamic organization of microtubules in guard cells of Vicia faba L. with diurnal cycle. Plant Cell Physiol. 39: 80-86. Gething, M.J. and Sambrook, J. (1992) Protein folding in the cell. Nature 355: 33-45. Gotow, K., Shimazaki, K., Kondo, N. and Syono, K. (1984) Photosynthesis-dependent volume regulation in guard cell protoplasts from Vicia faba L. Plant Cell Physiol. 25: 671-675. Haendler, B., Hofer-Warbinek, R. and Hofer, E. (1987) Complementary DNA for human T-cell cyclophilin. EMBO J. 6: 947-950. Handchumacher, R.E., Harding, M.W., Rice, J. and Drugge, R.J. (1984) Cyclophilin: a specific cytosolic binding protein for cyclosporin A. Science 226: 544-546. Hedrich, R. and Schroeder, J.I. (1989) The physiology of ion channels and electrogenic pumps in higher plants. Annu. Rev. Plant Physiol. 40: 539-569. 59 Kinoshita, T., Shimazaki, K. and Nishimura, M. (1993) Phosphorylation and dephosphorylation of guard-cell proteins from Viciafaba L. in response to light and dark. Plant Physiol. 102: 917-923. Lippuner, V., Chou, I.T., Scott, S.V., Ettinger, W.F., Theg, S.M. and Gasser, C.S. (1994) Cloning and characterization of chloroplast and cytosolic forms of cyclophilin from Arabidopsis thaliana. J. Biol. Chem. 269: 7863-7868. Liu, J., Farmer, J.D., Lane, W.S., Friedman, J., Weissman, I. and Schreiber, S.L. (1991) Calcineurin is a common target of cyclophilincyclosporin A and FKBP-FK506 complex. Celt 66: 807-815. Luan, S., Li, W., Rusnak, F., Assmann, S.M. and Schreiber, S.L. (1993) Immunosuppressants implicate protein phosphatase regulation of K + channels in guard cells. Proc. Natl. Acad. Sci. USA 90: 2202-2206. Luan, S., Albers, M.W. and Schreiber, S.L. (1994a) Light-regulated, tissue-specific immunophilins in a higher plant. Proc. Natl. Acad. Sci. USA 91: 984-988. Luan, S., Lane, W.S. and Schreiber, S.L. (1994b) pCyP B: a chloroplast-localized, heat shock-responsive cyclophilin from fava bean. Plant Cell 6: 885-892. Maniatis, T., Fitsch, E.F. and Sambrook, J. (1982) Molecular Cloning. In a Laboratory Manual. Cold Spring Harbor Laboratory Press, New York. Marivet, J., Margis-Pinheiro, M., Frendo, P. and Burkard, G. (1994) Bean cyclophilin gene expression during plant development and stress conditions. Plant Mol. Biol. 26: 1181-1189. Marivet, J., Frendo, P. and Burkard, G. (1995) DNA sequence analysis of cyclophilin gene from maize: developmental expression and regulation by salicylic acid. Mol. Gen. Genet. 247: 222-228. Schneuwly, S., Shortridge, R.D., Larrivee, D.C., Ono, T., Ozaki, M. and Pak, W.L. (1989) Drosophila Nina A gene encodes an eye-specific cyclophilin (cyclosporin A binding protein). Proc. Natl. Acad. Sci. USA 86: 5390-5394. Schreiber, S.L. (1991) Chemistry and biology of the immunophilins and their immunosuppressive ligands. Science 251: 283-287. Schroeder, J.I. and Hagiwara, S. (1989) Cytosolic calcium regulates ion channels in the plasma membrane of Viciafaba guard cells. Nature 338: 427-430. Shimazaki, K., Gotow, K. and Kondo, N. (1982) Photosynthetic properties of guard cell protoplasts from Viciafaba L. Plant Cell Physiol. 23: 871-879. Shimazaki, K., lino, M. and Zeiger, E. (1986) Blue light-dependent proton extrusion by guard-cell protoplasts of Viciafaba. Nature 319: 324-326. Shimazaki, K., Kinoshita, T. and Nishimura, M. (1992) Involvement of calmodulin and calmodulin-dependent myosin light chain kinase in blue light-dependent H + pumping by guard cell protoplasts from Viciafaba L. Plant Physiol. 99: 1416-1421. Sillen, L.G. and Martell, A.E. (1971) Stability Constants of Metal-Ion Complexes. Special Publication No. 25. The Chemical Society, London. Zeiger, E. (1983) The biology of stomatal guard cells. Annu. Rev. Plant Physiol. 34: 441-475. Zeiger, E. and Schwartz, A. (1982) Longevity of guard cell chloroplasts in falling leaves: implication for stomatal function and cellular aging. Science 218: 680-682. (Received August 18, 1998; Accepted October 29, 1998)