video slide - Wayne State University
... Now, here is one of the central problems of biology. Much of what is going on in a cell, as we have seen, is carried out by proteins. There are all kinds of proteins, depending on the sequence of their 20 amino acids: ...
... Now, here is one of the central problems of biology. Much of what is going on in a cell, as we have seen, is carried out by proteins. There are all kinds of proteins, depending on the sequence of their 20 amino acids: ...
Metabolic regulation of nitrogen fixation in Rhodospirillum rubrum
... ‘switched-off’ until a sudden change in fixed nitrogen (increased concentrations) or energy status appears. Neilson and Nordlund [3] showed that upon addition of low concentrations of ammonium, asparagine or glutamine, nitrogenase was reversibly inactivated within minutes, and this phenomenon was al ...
... ‘switched-off’ until a sudden change in fixed nitrogen (increased concentrations) or energy status appears. Neilson and Nordlund [3] showed that upon addition of low concentrations of ammonium, asparagine or glutamine, nitrogenase was reversibly inactivated within minutes, and this phenomenon was al ...
This presentation introduces the topics we will
... used. The resulting mixture of peptides is analysed by mass spectrometry. This yields a set of molecular mass values, which are searched against a database of protein sequences using a search engine. For each entry in the protein database, the search engine simulates the known cleavage specificity o ...
... used. The resulting mixture of peptides is analysed by mass spectrometry. This yields a set of molecular mass values, which are searched against a database of protein sequences using a search engine. For each entry in the protein database, the search engine simulates the known cleavage specificity o ...
Advances in affinity purification mass spectrometry of
... Biological research is enabled by its available technologies. One key technological development was that of highthroughput DNA sequencing, which enabled the determination of the complete DNA sequence of several eukaryotic species. This spawned the field of functional genomics and several subsequent ...
... Biological research is enabled by its available technologies. One key technological development was that of highthroughput DNA sequencing, which enabled the determination of the complete DNA sequence of several eukaryotic species. This spawned the field of functional genomics and several subsequent ...
Initiation of Innate Immune Responses in the
... The clotting system is an important reaction in both vertebrates and in invertebrates to prevent blood loss through wounds. The clotting system of a chelicerate, the horseshoe crab Tachypleus tridentatus, has been characterized in great detail (Iwanaga et al., 1998). The coagulation system of the ho ...
... The clotting system is an important reaction in both vertebrates and in invertebrates to prevent blood loss through wounds. The clotting system of a chelicerate, the horseshoe crab Tachypleus tridentatus, has been characterized in great detail (Iwanaga et al., 1998). The coagulation system of the ho ...
selection of antigens for antibody-based proteomics
... The human genome is predicted to contain ~20,500 protein-coding genes. The encoded proteins are the key players in the body, but the functions and localizations of most proteins are still unknown. Antibody-based proteomics has great potential for exploration of the protein complement of the human ge ...
... The human genome is predicted to contain ~20,500 protein-coding genes. The encoded proteins are the key players in the body, but the functions and localizations of most proteins are still unknown. Antibody-based proteomics has great potential for exploration of the protein complement of the human ge ...
Functional specialization of Medicago truncatula leaves and
... very eYcient retrieval to the ER (Pagny et al. 2000; Sriraman et al. 2004) while in other cases some of the protein escapes the retrieval mechanism and passes through the Golgi (Ko et al. 2003; Triguero et al. 2005). Saturation of the KDEL receptor has also been demonstrated (Crofts et al. 1999). In ...
... very eYcient retrieval to the ER (Pagny et al. 2000; Sriraman et al. 2004) while in other cases some of the protein escapes the retrieval mechanism and passes through the Golgi (Ko et al. 2003; Triguero et al. 2005). Saturation of the KDEL receptor has also been demonstrated (Crofts et al. 1999). In ...
Slow Protein Conformational Change, Allostery and
... (such as the transition state theory) states that the dynamics along the RC is much slower than fluctuations along all other coordinates. Consequently, for any given RC position, one may assume other degrees of freedom approaches approximately equilibrium. This is the so-called adiabatic approximati ...
... (such as the transition state theory) states that the dynamics along the RC is much slower than fluctuations along all other coordinates. Consequently, for any given RC position, one may assume other degrees of freedom approaches approximately equilibrium. This is the so-called adiabatic approximati ...
Alpha-COPI Coatomer Protein Is Required for Rough Endoplasmic
... To determine if amino acids in the midgut lumen are sufficient to trigger RER whorl unwinding in midgut epithelial cells of Ae. aegypti mosquitoes, females were fed an artificial amino acid meal and dissected midguts were characterized for ultrastructural changes at the subcellular level using elect ...
... To determine if amino acids in the midgut lumen are sufficient to trigger RER whorl unwinding in midgut epithelial cells of Ae. aegypti mosquitoes, females were fed an artificial amino acid meal and dissected midguts were characterized for ultrastructural changes at the subcellular level using elect ...
Preparation of cell lysates For immunoblotting, 5 x 105
... included in the scan line. To enable this trace to be converted to [Ca2+] a series of calibration solutions were used at the end of each Ca2+ spark measurement period incorporating 10 mmol/L EGTA as previously described 6. In all experiments concerning Ca2+ sparks, the [Ca2+] in the test solution wa ...
... included in the scan line. To enable this trace to be converted to [Ca2+] a series of calibration solutions were used at the end of each Ca2+ spark measurement period incorporating 10 mmol/L EGTA as previously described 6. In all experiments concerning Ca2+ sparks, the [Ca2+] in the test solution wa ...
Determining Lactose Content In Milk by Polarimetry
... polarimeter tube. It is affected by temperature (20°C reference temperature) and wavelength (usually the sodium D line, 589 nm, is used), and can be measured using the following formula: ...
... polarimeter tube. It is affected by temperature (20°C reference temperature) and wavelength (usually the sodium D line, 589 nm, is used), and can be measured using the following formula: ...
(Rev. 9/04), Biographical Sketch Format Page
... Dylan Hixon Prize for Teaching Excellence in the Natural Sciences at Yale B. Selected peer-reviewed publications (in chronological order) Koelle, M.R., Talbot, W.S., Segraves, W.A., Bender, M.T., Cherbas, P. and Hogness, D.S. (1991) The Drosophila EcR gene encodes an ecdysone receptor, a new member ...
... Dylan Hixon Prize for Teaching Excellence in the Natural Sciences at Yale B. Selected peer-reviewed publications (in chronological order) Koelle, M.R., Talbot, W.S., Segraves, W.A., Bender, M.T., Cherbas, P. and Hogness, D.S. (1991) The Drosophila EcR gene encodes an ecdysone receptor, a new member ...
Jeopardy Review
... An enzyme can react with how many different substrates? A: What is a one? S2C06 Jeopardy Review ...
... An enzyme can react with how many different substrates? A: What is a one? S2C06 Jeopardy Review ...
Protein Targeting to the Nuclear Pore. What Can
... Harley M.S. Smith and Natasha V. Raikhel* Department of Energy Plant Research Laboratory, Michigan State University, East Lansing, Michigan 48824–1312 Characteristic of eukaryotic cells are the numerous types of membrane-bound organelles or compartments found in the cytoplasm, with each type carryin ...
... Harley M.S. Smith and Natasha V. Raikhel* Department of Energy Plant Research Laboratory, Michigan State University, East Lansing, Michigan 48824–1312 Characteristic of eukaryotic cells are the numerous types of membrane-bound organelles or compartments found in the cytoplasm, with each type carryin ...
Sequence database similarity search
... 5. It has been reported that a transcript annotated as a long non-coding RNA in mouse genome encodes a peptide of 34 amino acids with the following sequence: MAEKESTSPHLIVPILLLVGWIVGCIIVIYIVFF. It was also suggested that a transcript annotated as a long non-coding RNA in human genome (Accession NR_0 ...
... 5. It has been reported that a transcript annotated as a long non-coding RNA in mouse genome encodes a peptide of 34 amino acids with the following sequence: MAEKESTSPHLIVPILLLVGWIVGCIIVIYIVFF. It was also suggested that a transcript annotated as a long non-coding RNA in human genome (Accession NR_0 ...
Microtubules assemblies on nanostructures
... 1.5 m on the side, onto which the various molecules under study can be suspended. The samples are created using electron beam pattern generator where, with high resolution, several test structures are defined and are such that there are many shape combinations on one chip. Figure 4 (a) and (b) disp ...
... 1.5 m on the side, onto which the various molecules under study can be suspended. The samples are created using electron beam pattern generator where, with high resolution, several test structures are defined and are such that there are many shape combinations on one chip. Figure 4 (a) and (b) disp ...
Mapping allosteric connections from the receptor G proteins
... Ras, and a helical domain that buries the guanine nucleotidebinding pocket in the core of the protein. Switch I is a loop that forms one of the two linkers between these domains by connecting the ␣F-helix of the helical domain to the 2-strand of the GTPase domain (Fig. 1 A). Upon exchange of GDP fo ...
... Ras, and a helical domain that buries the guanine nucleotidebinding pocket in the core of the protein. Switch I is a loop that forms one of the two linkers between these domains by connecting the ␣F-helix of the helical domain to the 2-strand of the GTPase domain (Fig. 1 A). Upon exchange of GDP fo ...
Collagen Binding Proteins Derived from the Embryonic Fibroblast
... To test the effects of synthetic peptides on the binding of CBP to collagen, octylglucoside extracts of 125I-surface labeled whole cells were applied to 200/zl columns of Type I collagen-Sepharose, fibronectin-Sepharose or albuminSepharose as described above. After washing to remove unbound material ...
... To test the effects of synthetic peptides on the binding of CBP to collagen, octylglucoside extracts of 125I-surface labeled whole cells were applied to 200/zl columns of Type I collagen-Sepharose, fibronectin-Sepharose or albuminSepharose as described above. After washing to remove unbound material ...
bi6103-20feb04 - NUS School of Computing
... • Stage 1: Baum-Welch is used for maximum likelihood estimation from “diluted” labeled training data. As precise end of TM is only approximately known, we “dilute” by unlabeling 3 residues on each side of a helix boundary to accommodate this • Stage 2: Baum-Welch is used for maximum likelihood estim ...
... • Stage 1: Baum-Welch is used for maximum likelihood estimation from “diluted” labeled training data. As precise end of TM is only approximately known, we “dilute” by unlabeling 3 residues on each side of a helix boundary to accommodate this • Stage 2: Baum-Welch is used for maximum likelihood estim ...
Single-molecule super-resolution microscopy (STORM)
... been the lack of imaging tools with sufficient spatial resolution, because accuracy of ~10 nanometres (corresponding to the diameter of a single actin filament) is required to unequivocally assign interactions between molecules of actin-binding proteins and an actin filament. Over the last decade, t ...
... been the lack of imaging tools with sufficient spatial resolution, because accuracy of ~10 nanometres (corresponding to the diameter of a single actin filament) is required to unequivocally assign interactions between molecules of actin-binding proteins and an actin filament. Over the last decade, t ...
supp - Springer Static Content Server
... motifs (RRM) and two glycine rich auxiliary domains (Honore et al., 1995). Members of this family specifically recognize poly-G RNA sequences (G-tracts) (Swanson and Dreyfuss, 1988) that are frequent splicing recognition elements found both in introns and exons and are crucial for splicing regulatio ...
... motifs (RRM) and two glycine rich auxiliary domains (Honore et al., 1995). Members of this family specifically recognize poly-G RNA sequences (G-tracts) (Swanson and Dreyfuss, 1988) that are frequent splicing recognition elements found both in introns and exons and are crucial for splicing regulatio ...
PROTEIN SEQUENCING First Sequence
... • Direct sequencing is applicable to peptides that have up to about 50 residues only. • Problems which occur after lengthy reactions – Incomplete reactions – Accumulation of impurities from side reactions • Solution: use enzymes to break down the polypeptide chain into shorter fragments – Proteolyti ...
... • Direct sequencing is applicable to peptides that have up to about 50 residues only. • Problems which occur after lengthy reactions – Incomplete reactions – Accumulation of impurities from side reactions • Solution: use enzymes to break down the polypeptide chain into shorter fragments – Proteolyti ...
a review of the BLAST meeting, ï - Bacterial Locomotion and Signal
... environmental changes and act upon them. In this regard, life has solved many problems that engineers face when designing autonomous systems. Imagine designing a simple robot capable of navigating between two points. Any design would involve sensors to guide the robot, a motor to move it, and a set ...
... environmental changes and act upon them. In this regard, life has solved many problems that engineers face when designing autonomous systems. Imagine designing a simple robot capable of navigating between two points. Any design would involve sensors to guide the robot, a motor to move it, and a set ...
Intrinsically disordered proteins
An intrinsically disordered protein (IDP) is a protein that lacks a fixed or ordered three-dimensional structure. IDPs cover a spectrum of states from fully unstructured to partially structured and include random coils, (pre-)molten globules, and large multi-domain proteins connected by flexible linkers. They constitute one of the main types of protein (alongside globular, fibrous and membrane proteins).The discovery of IDPs has challenged the traditional protein structure paradigm, that protein function depends on a fixed three-dimensional structure. This dogma has been challenged over the last decades by increasing evidence from various branches of structural biology, suggesting that protein dynamics may be highly relevant for such systems. Despite their lack of stable structure, IDPs are a very large and functionally important class of proteins. In some cases, IDPs can adopt a fixed three-dimensional structure after binding to other macromolecules.