* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
Download Mass Spectrometry of Prions
Intrinsically disordered proteins wikipedia , lookup
Rosetta@home wikipedia , lookup
Protein design wikipedia , lookup
Structural alignment wikipedia , lookup
Western blot wikipedia , lookup
Protein mass spectrometry wikipedia , lookup
Protein domain wikipedia , lookup
List of types of proteins wikipedia , lookup
Protein purification wikipedia , lookup
Circular dichroism wikipedia , lookup
Protein folding wikipedia , lookup
Alpha helix wikipedia , lookup
Protein–protein interaction wikipedia , lookup
Homology modeling wikipedia , lookup
Nuclear magnetic resonance spectroscopy of proteins wikipedia , lookup
Protein structure prediction wikipedia , lookup
Prion Project Presented by Béla Reiz Supervisor: Dr. Liang Li Outline 1. Introduction 2. Structure 3. Experimental 4. Future Work 1.Introduction What are prions? • Prions are a type of infectious particles that turn out to be molecules of a normal body protein that have changed their three-dimensional configuration. • “Prion” is derived from small proteinaceous infectious particle which resists procedures that modify nucleic acids. • PrP = prion-related protein or protease-resistant protein The normal protein • is called PrPC (for cellular) • is a naturally occurring protein encoded by the Prnp gene • is a transmembrane glycoprotein predominantly found on the surface of neurons • its secondary structure is dominated by 3 alpha helices • is soluble • is easily digested by proteases • in a given cell type PrPC is necessary but not sufficient for the conversion of prions What is the physiological function of PrPC • function is still elusive • functions attributed so far: – immunoregulation – signal transduction – copper binding – synaptic transmission – induction or protection against apoptosis A. Aguzzi, Cell 116, 313 (2004) The abnormal protein • is called PrPSc (for scrapie) • same primary structure as the PrPC 1 • its secondary structure is dominated by beta sheets • is insoluble • is highly resistant to digestion by proteases • PrPSc molecules bind and form aggregates in the cytoplasmic vesicles of diseased individuals • if in contact with PrPc it is capable of converting it into PrPSc 1 Stanley B. Prusiner, Biochemistry, 32, 1991 (1993) The PRION diseases (animal) Disease Mechanism of pathogenesis Scrapie (sheep) Infection in genetically susceptible sheep Bovine Spongiform Encephalopathy (BSE, cattle) Infection with prion-contaminated MBM Transmissible mink Encephalopathy (TME, mink) Infection with prions from sheep and cattle Chronic wasting disease (CWD, mule deer, elk) Unknown Feline spongiform encephalopathy Infection with prion-contaminated (FSE, cats) MBM Exotic ungulate encephalopathy (EUE, greater kudu, nyalal, oryx) Infection with prion-contaminated MBM Stanley B. Prusiner, Science, 278, 245 (1997) The PRION diseases (human) Disease Mechanism of pathogenesis Kuru (Fore people) Infection through ritualistic cannibalism Variant Creutzfeld-Jakob disease (vCJD) Infection from prion-contaminated HGH, dura mater grafts etc. Familial Creutzfeld-Jakob disease (fCJD) Germline mutation in PrP gene Gerstmann-Sträussler-Scheinker disease (GSS) Germline mutation in PrP gene Fatal familial insomnia (FFI) Germline mutation in PrP gene (D178N and M129) Sporadic Creutzfeld-Jakob disease Somatic mutation of spontaneuous (sCJD) conversion of PrPC into PrPSc? Stanley B. Prusiner, Science, 278, 245 (1997) Prion infection mechanism Biosafety Hamster recombinant protein • CL1 requirements Bovine PrP • CL2 requirements • seal joints in surfaces • bag-in / bag-out HEPA BSC’s • autoclave in laboratory • dedicated laboratory & equipment Protein only model of infection T. Alper, W.A. Cramp, D.A. Haig, M.C. Clarke, Nature, 214, 764 (1967). “PRION” • After infection and a prolonged incubation period, the scrapie agent causes a degenerative disease of the central nervous system in sheep and goats. Six lines of evidence including sensitivity to proteases demonstrate that this agent contains a protein that is required for infectivity. Although the scrapie agent is irreversibly inactivated by alkali, five procedures with more specificity for modifying nucleic acids failed to cause inactivation. The agent shows heterogeneity with respect to size, apparently a result of its hydrophobicity; the smallest form may have a molecular weight of 50,000 or less. Because the novel properties of the scrapie agent distinguish it from viruses, plasmids, and viroids, a new term "prion" is proposed to denote a small proteinaceous infectious particle which is resistant to inactivation by most procedures that modify nucleic acids. Knowledge of the scrapie agent structure may have significance for understanding the causes of several degenerative diseases. Stanley B. Prusiner, Science, 216, 136 (1982) Identification of PrP using HPLC-MS Schinina et al., Pure Appl. Chem., 75, 2-3 (2003) Future of PRION science • What is the precise physical structure of the protein? • What is the biochemical basis of the prion strain? • Is there a species barrier? • What factors determine the species barrier in prion infections? • What are the host susceptibility factors that promote prion infection? • What are the molecular mechanisms that will underpin an efficacious therapy? 2.Structure Structure of the PrPC • flexible N-terminus • 3 alpha helices • 2 small beta strands • 2 N – glycosylations Structure of the PrPC Figure 1. Primary structure of the cellular PrP including post-translational modifications A. Aguzzi, M. Heikenwalder, Microbiology, 4, 765 (2006) Structure of the PrPC Figure 2. Tertiary structure of the cellular PrP A. Aguzzi, M. Heikenwalder, Microbiology, 4, 765 (2006) 3.Experimental Objective Use Mass Spectrometry to characterize the aggregating and aggregated PrPSc. The SHPrPC 90 – 231 • Sequence of the SHPrPC with the purification tag: MGSSHHHHHHSSGLVPRGSHMLEGQGGGTHNQWNKPSKPKTNMK HMAGAAAAGAVVGGLGGYMLGSAMSRPMMHFGNDWEDRYYRENM NRYPNQVYYRPVDQYNNQNNFVHDCVNITIKQHTVTTTTKGENFTET DIKIMERVVEQMCTTQYQKESQAYYDGRRSS • Number of AA: 166 • Molecular weight: 18866.9 Da • Theoretical pI: 8.85 • Instability index: 38.01 • GRAVY: -0.989 Experimental Procedure Protein MS Digestion (Peptides) MS LC-MALDI MS MSMS Database Search HPLC spectrum of the SHPrPC tryptic digest Sequence coverage for the Tryptic digest • Sequence identified: 126 AA MGSSHHHHHHSSGLVPRGSHMLEGQGGGTHNQWNKPSKPKTN MKHMAGAAAAGAVVGGLGGYMLGSAMSRPMMHFGNDWEDRYY RENMNRYPNQVYYRPVDQYNNQNNFVHDCVNITIKQHTVTTTTKG ENFTETDIKIMERVVEQMCTTQYQKESQAYYDGRRSS Identified only by MS Coverage: 76% • Sequence identified by MSMS: 97 AA • Coverage: 58% Sequence coverage for the Chymotryptic digest 4.Future Work Future Work Use MS to determine: 1. surface residue location 2. cysteine placement 3. residue-residue proximity 4. residue-specific hydrogen exchange 5. secondary structure Chemical modification of surface exposed residues using N-bromosuccinimide (NBS) Yash P. Myer, Biochemistry, 11, 23 (1972) Nitrosylation of surface exposed Tyrosine residues using tetranitromethane (TNM) J.F. Leite, M. Cascio, Biochemistry, 41, 19 (2002) Thanks! • Dr. Liang Li • All Li group members