• Study Resource
  • Explore Categories
    • Arts & Humanities
    • Business
    • Engineering & Technology
    • Foreign Language
    • History
    • Math
    • Science
    • Social Science

    Top subcategories

    • Advanced Math
    • Algebra
    • Basic Math
    • Calculus
    • Geometry
    • Linear Algebra
    • Pre-Algebra
    • Pre-Calculus
    • Statistics And Probability
    • Trigonometry
    • other →

    Top subcategories

    • Astronomy
    • Astrophysics
    • Biology
    • Chemistry
    • Earth Science
    • Environmental Science
    • Health Science
    • Physics
    • other →

    Top subcategories

    • Anthropology
    • Law
    • Political Science
    • Psychology
    • Sociology
    • other →

    Top subcategories

    • Accounting
    • Economics
    • Finance
    • Management
    • other →

    Top subcategories

    • Aerospace Engineering
    • Bioengineering
    • Chemical Engineering
    • Civil Engineering
    • Computer Science
    • Electrical Engineering
    • Industrial Engineering
    • Mechanical Engineering
    • Web Design
    • other →

    Top subcategories

    • Architecture
    • Communications
    • English
    • Gender Studies
    • Music
    • Performing Arts
    • Philosophy
    • Religious Studies
    • Writing
    • other →

    Top subcategories

    • Ancient History
    • European History
    • US History
    • World History
    • other →

    Top subcategories

    • Croatian
    • Czech
    • Finnish
    • Greek
    • Hindi
    • Japanese
    • Korean
    • Persian
    • Swedish
    • Turkish
    • other →
 
Profile Documents Logout
Upload
Name
Name

... 2. How can you tell if a molecule is organic or inorganic? 3. What are the four categories of organic macromolecules? 4. Which three atoms are found in all of the organic macromolecules? 5. Explain dehydration synthesis and hydrolysis reactions. 6. Draw the following molecules: fats, nucleotide, ami ...
Enzymes - SAVE MY EXAMS!
Enzymes - SAVE MY EXAMS!

Chemistry 100 Name
Chemistry 100 Name

... losing the shape of the protein happens when meat or eggs are cooked loss of solubility breaking the amide linkage happens when a strong acid is added loss of biological activity when the chain is cut into individual amino acids breaks hydrogen bonds unfolds the protein destroys primary structure br ...
Worksheet 16
Worksheet 16

... losing the shape of the protein happens when meat or eggs are cooked loss of solubility breaking the amide linkage happens when a strong acid is added loss of biological activity when the chain is cut into individual amino acids breaks hydrogen bonds unfolds the protein destroys primary structure br ...
C454_lect10 - University of Wisconsin
C454_lect10 - University of Wisconsin

... regulate biological function ...
1: Making new DNA 2: Making RNA from DNA 3: Making Protein
1: Making new DNA 2: Making RNA from DNA 3: Making Protein

... 3: Making Protein from RNA a) How many DNA or RNA base pairs code for each amino acid? b) Write an example of DNA  RNA  Amino Acid c) Suppose there was a change in the base sequence in DNA. What would happen to the RNA or Protein? ...
MS Word File
MS Word File

... Nonpolar (hydrophobic):glycine, alanine, valine, leucine, isoleucine, methionine, phenylalanine, tryptophan and proline ...
Biomolecules - Kendriya Vidyalaya, Bailey Road, Patna
Biomolecules - Kendriya Vidyalaya, Bailey Road, Patna

...  DNA contains four bases viz. adenine (A), guanine (G), cytosine (C) and thymine (T).  RNA also contains four bases, the first three bases are same as in DNA but the fourth one is uracil (U).  A unit formed by the attachment of a base to 1’position of sugar is known as nucleoside. ...
Lecture 27
Lecture 27

... In this model the tRNA would "ratchet" its way through the ribosome undergoing 50° rotations along its longitudinal axis from A to P. This model has received support from EM and X-ray studies. ...
Origin of Life: I Monomers to Polymers
Origin of Life: I Monomers to Polymers

DNA and RNA review
DNA and RNA review

... How do the purines and pyrimidines differ structurally? What type of bond holds the 2 strands of DNA together? Describe this type of bond. Explain the complementary base pairing of the nitrogen bases in DNA. What is produced in DNA replication? Why is DNA replication necessary? What important roles ...
All the following is correct about ribosomes EXCEPT
All the following is correct about ribosomes EXCEPT

... a. they are both polymers of glucose b. they are both used for energy storage in plants c. they are both found in humans d. none of them ...
Organic/Bio Chemistry
Organic/Bio Chemistry

... Sometimes adding more concentration has little or no effect ...
Previously in Bio308
Previously in Bio308

... How would a neuropeptide get made (in general terms)? What are the basic parts of DNA, RNA, and proteins? What is the difference between hnRNA, mRNA and tRNA? ...
Nadine Noelting
Nadine Noelting

... PLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPE PDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSS FGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQR IEVLDNTQQLKILADSINSEIGILCSALQKIK ...
Human Nutrition – Exam #1 1. Which of the following is a
Human Nutrition – Exam #1 1. Which of the following is a

Shier, Butler, and Lewis: Hole`s Human Anatomy and Physiology
Shier, Butler, and Lewis: Hole`s Human Anatomy and Physiology

... 11. The interaction of the enzyme-substrate complex causes chemical bonds to be strained in a substrate in a way that makes a chemical reaction more likely to occur. 12. The speed of enzyme-catalyzed reactions depends on the number of enzymes and substrate molecules. 13. Metabolic pathways are seque ...
STUDY GUIDE SEMESTER 2 EXAM 4 Dr. Marks Name: Class
STUDY GUIDE SEMESTER 2 EXAM 4 Dr. Marks Name: Class

... During DNA replication, a complementary strand of DNA is made from each original DNA strand. Thus, if a portion of the original strand is CCTAGCT, then the new strand will be ...
Chemistry of Living Things revised
Chemistry of Living Things revised

... reaction they catalyze. • In organisms, _____________ allow the chemical reactions of ______________ to take place more efficiently than they otherwise would at body temperature. • For example, amino acids are produced from protein digestion. The enzymes needed for this reaction are not changed but ...
PowerPoint Rubric: Biochemistry worksheet
PowerPoint Rubric: Biochemistry worksheet

chapter 5 the structure & function of macromolecules
chapter 5 the structure & function of macromolecules

... double bonds between the carbons in the chain. (Liquids at room temp due to “kinks” in the fatty acid which prevents it from solidifying) Fat Molecules are storage for energy. ...
Lehninger Principles of Biochemistry
Lehninger Principles of Biochemistry

... Aminotransferases catalyze transfer of amino groups of amino acids to a-ketoglutarate ...
The Molecules of Life Outline
The Molecules of Life Outline

... Anabolic steroids are usually synthetic forms of testosterone.  Some athletes use them to build up their muscles quickly.  However, these substances can pose serious health risks.  ...
Lab #8
Lab #8

... Under many food processing conditions, reducing sugars produce brown colors that are desirable and important in some foods. Other brown colors obtained upon heating or during longterm storage of foods are undesirable. Common browning of foods on heating or on storage is usually due to a chemical rea ...
RESEARCH NOTES
RESEARCH NOTES

... PhWl~lOlO”i”~ where A/A0 =remaining activity holds, a straight line should be obtained. It can be seen from the figure that such is not the case for phenylalanine, I nor was it the case for the other three amino acids tested. ...
< 1 ... 706 707 708 709 710 711 712 713 714 ... 774 >

Biosynthesis



Biosynthesis (also called biogenesis or anabolism) is a multi-step, enzyme-catalyzed process where substrates are converted into more complex products in living organisms. In biosynthesis, simple compounds are modified, converted into other compounds, or joined together to form macromolecules. This process often consists of metabolic pathways. Some of these biosynthetic pathways are located within a single cellular organelle, while others involve enzymes that are located within multiple cellular organelles. Examples of these biosynthetic pathways include the production of lipid membrane components and nucleotides.The prerequisite elements for biosynthesis include: precursor compounds, chemical energy (e.g. ATP), and catalytic enzymes which may require coenzymes (e.g.NADH, NADPH). These elements create monomers, the building blocks for macromolecules. Some important biological macromolecules include: proteins, which are composed of amino acid monomers joined via peptide bonds, and DNA molecules, which are composed of nucleotides joined via phosphodiester bonds.
  • studyres.com © 2026
  • DMCA
  • Privacy
  • Terms
  • Report