* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Download WSB2 (Human) Recombinant Protein (Q01)
Survey
Document related concepts
Protein design wikipedia , lookup
Protein folding wikipedia , lookup
Homology modeling wikipedia , lookup
Protein mass spectrometry wikipedia , lookup
Protein domain wikipedia , lookup
List of types of proteins wikipedia , lookup
Bimolecular fluorescence complementation wikipedia , lookup
Western blot wikipedia , lookup
Protein structure prediction wikipedia , lookup
Nuclear magnetic resonance spectroscopy of proteins wikipedia , lookup
Protein moonlighting wikipedia , lookup
Transcript
WSB2 (Human) Recombinant Protein (Q01) Catalog Number: H00055884-Q01 Regulation Status: For research use only (RUO) Product Description: Human WSB2 partial ORF ( AAH15887, 1 a.a. - 105 a.a.) recombinant protein with GST-tag at N-terminal. Sequence: MEAGEEPLLLAELKPGRPHQFDWKSSCETWSVAFSP DGSWFAWSQGHCIVKLIPWPLEEQFIPKGFEAKSRSS KNETKGRGSPKEKTLDCGQIVWGLAFSPWPSP Theoretical MW (kDa): 37.29 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 55884 Gene Symbol: WSB2 Gene Alias: MGC10210, SBA2 Gene Summary: This gene encodes a member of the WD-protein subfamily. The encoded protein contains five WD-repeats spanning most of the protein and an SOCS box in the C-terminus. The SOCS box may act as a bridge between specific substrate-binding domains and E3 ubiquitin protein ligases. [provided by RefSeq] Page 1/1 Powered by TCPDF (www.tcpdf.org)