Download WSB2 (Human) Recombinant Protein (Q01)

Survey
yes no Was this document useful for you?
   Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Document related concepts

Ubiquitin wikipedia , lookup

Protein design wikipedia , lookup

Protein folding wikipedia , lookup

Homology modeling wikipedia , lookup

Proteomics wikipedia , lookup

Protein mass spectrometry wikipedia , lookup

Protein domain wikipedia , lookup

List of types of proteins wikipedia , lookup

Bimolecular fluorescence complementation wikipedia , lookup

Western blot wikipedia , lookup

Protein structure prediction wikipedia , lookup

Nuclear magnetic resonance spectroscopy of proteins wikipedia , lookup

Protein moonlighting wikipedia , lookup

Protein–protein interaction wikipedia , lookup

Protein purification wikipedia , lookup

Transcript
WSB2 (Human) Recombinant
Protein (Q01)
Catalog Number: H00055884-Q01
Regulation Status: For research use only (RUO)
Product Description: Human WSB2 partial ORF (
AAH15887, 1 a.a. - 105 a.a.) recombinant protein with
GST-tag at N-terminal.
Sequence:
MEAGEEPLLLAELKPGRPHQFDWKSSCETWSVAFSP
DGSWFAWSQGHCIVKLIPWPLEEQFIPKGFEAKSRSS
KNETKGRGSPKEKTLDCGQIVWGLAFSPWPSP
Theoretical MW (kDa): 37.29
Applications: AP, Array, ELISA, WB-Re
(See our web site product page for detailed applications
information)
Protocols: See our web site at
http://www.abnova.com/support/protocols.asp or product
page for detailed protocols
Preparation Method: in vitro wheat germ expression
system
Purification: Glutathione Sepharose 4 Fast Flow
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced
Glutathione, pH=8.0 in the elution buffer.
Storage Instruction: Store at -80°C. Aliquot to avoid
repeated freezing and thawing.
Entrez GeneID: 55884
Gene Symbol: WSB2
Gene Alias: MGC10210, SBA2
Gene Summary: This gene encodes a member of the
WD-protein subfamily. The encoded protein contains five
WD-repeats spanning most of the protein and an SOCS
box in the C-terminus. The SOCS box may act as a
bridge between specific substrate-binding domains and
E3 ubiquitin protein ligases. [provided by RefSeq]
Page 1/1
Powered by TCPDF (www.tcpdf.org)