Survey
* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Download WSB2 (Human) Recombinant Protein (Q01)
Document related concepts
Protein design wikipedia , lookup
Protein folding wikipedia , lookup
Homology modeling wikipedia , lookup
Protein mass spectrometry wikipedia , lookup
Protein domain wikipedia , lookup
List of types of proteins wikipedia , lookup
Bimolecular fluorescence complementation wikipedia , lookup
Western blot wikipedia , lookup
Protein structure prediction wikipedia , lookup
Nuclear magnetic resonance spectroscopy of proteins wikipedia , lookup
Protein moonlighting wikipedia , lookup
Transcript
WSB2 (Human) Recombinant Protein (Q01) Catalog Number: H00055884-Q01 Regulation Status: For research use only (RUO) Product Description: Human WSB2 partial ORF ( AAH15887, 1 a.a. - 105 a.a.) recombinant protein with GST-tag at N-terminal. Sequence: MEAGEEPLLLAELKPGRPHQFDWKSSCETWSVAFSP DGSWFAWSQGHCIVKLIPWPLEEQFIPKGFEAKSRSS KNETKGRGSPKEKTLDCGQIVWGLAFSPWPSP Theoretical MW (kDa): 37.29 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 55884 Gene Symbol: WSB2 Gene Alias: MGC10210, SBA2 Gene Summary: This gene encodes a member of the WD-protein subfamily. The encoded protein contains five WD-repeats spanning most of the protein and an SOCS box in the C-terminus. The SOCS box may act as a bridge between specific substrate-binding domains and E3 ubiquitin protein ligases. [provided by RefSeq] Page 1/1 Powered by TCPDF (www.tcpdf.org)
