* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Download Homology modeling workshop
Genetic code wikipedia , lookup
Magnesium transporter wikipedia , lookup
Multi-state modeling of biomolecules wikipedia , lookup
G protein–coupled receptor wikipedia , lookup
Expression vector wikipedia , lookup
Metalloprotein wikipedia , lookup
Gene expression wikipedia , lookup
Interactome wikipedia , lookup
Artificial gene synthesis wikipedia , lookup
Point mutation wikipedia , lookup
Western blot wikipedia , lookup
Protein purification wikipedia , lookup
Proteolysis wikipedia , lookup
Protein–protein interaction wikipedia , lookup
Homology Modeling Workshop GHIKLSYTVNEQNLKPERFFYTSAVAIL Outline: • Introduction to protein structure & databases • Structure prediction approaches – Ab-initio – Threading – Homology modeling • Hands ON From Sequence to Structure Protein structure is hierarchic: • Primary – sequence of covalently attached amino acid • Secondary – local 3D patterns (helices, sheets, loops) • Tertiary – overall 3D fold • Quaternary – two or more protein chains From Sequence to Structure • All information about the native structure of a protein is encoded in the amino acid sequence + its native solution environment. • Many possible conformation still only one or few native folds are exhibited for each protein (Levinthal’s paradox) • Protein folding is driven by various forces: – Ionic forces – Hydrogen bonds – The hydrophobic affect – ... Protein 3D Structures A protein’s structure has a critical effect on its function: 1. Binding pockets PDB ID 1nw7 Protein 3D Structures A protein’s structure has a critical effect on its function: 2. Areas of specific chemical\electrical properties Protein 3D Structures A protein’s structure has a critical effect on its function: 3. Importance of the global fold for function Motivation to Acquire a Structure • Identifying active and binding sites • Characterization of the protein’s mechanism (catalysis & interactions) • Searching for ligand of a given binding site • Understanding the molecular basis of diseases • Designing mutants • Drug design • And more... Determining Structure • NMR • X-ray diffraction • Electron Microscopy Why predict protein structure if we can use experimental tools to determine it? • Experimental methods are slow and expensive • Some structures were failed to be solved • A representative family structure can suffice to deduce structures of the entire family sequences Protein databases Protein Sequence & Structure Databases Some of the available databases: • RCSB- the Protein Data Bank- all deposited structures • UniProt- main sequence database – SwissProt – Tremble • NCBI- lots of databases, including sequence and structures • PDBsum- combines structural & sequence data UniProt- Protein Sequence Database • UniProt is a collaboration between the European Bioinformatics Institute (EBI), the Swiss Institute of Bioinformatics (SIB) and the Protein Information Resource (PIR). • In 2002, the three institutes decided to pool their resources and expertise and formed the UniProt Consortium. UniProt- Protein Sequence Database • The world's most comprehensive catalog of information on proteins • Sequence, function & more… • Comprised mainly of the databases: – SwissProt –516081 entries– high quality annotation, nonredundant & cross-referenced to many other databases. – TrEMBL – 10618387 entries – computer translation of the genetic information from the EMBL Nucleotide Sequence Database many proteins are poorly annotated since only automatic annotation is generated UniProt- Protein Sequence Database UniProt- Protein Sequence Database Protein Data Bank (PDB) • The PDB archive contains information about experimentallydetermined structures of proteins, nucleic acids, and complex assemblies. • The structures in the archive range from tiny proteins and bits of DNA to complex molecular machines like the ribosome. • There are currently 57013 structures deposited in the PDB. However, taking out redundant sequences (e.g. 90%) reduces the number of structures to 19988… • Each structure receives a unique 4 letter ID Protein Data Bank (PDB) http://www.rcsb.org/pdb/home/home.do PDB ID: 3mht Protein Data Bank (PDB) http://www.rcsb.org/pdb/home/home.do Download structure The paper describing the structure Data concerning the structureresolution, R-value…. Display structure Protein Data Bank (PDB) Year PdbSum • A database providing an overview of all biological macromolecular structures • Connected to UniProt find the sequence accession of a known PDB ID • Detailed description of many structure properties, e.g.: – EC number – Chains & ligands and their interactions – Clefts – Secondary structure – FASTA sequence of structure… –… PdbSum PDB ID http://www.ebi.ac.uk/thornton-srv/databases/pdbsum/ Free text Search by sequence PdbSum Useful tabs UniProt accession Chains & ligands PdbSum Protein tab Secondary structurefrom the PDB More Sequences Than Structures • Discrepancy between the number of known sequences and solved structures: 5,047,807 UniRef90 entries vs. 25566 90% Non-redundant structures Computational methods are needed to obtain more structures Structure prediction approaches Structure Prediction Approaches 1. Homology (Comparative) Modeling Based on sequence similarity with a protein for which a structure has been solved. 2. Threading (Fold Recognition) Requires a structure similar to a known structure 3. Ab-initio fold prediction Not based on similarity to a sequence\structure Ab-initio Structure prediction from “first principals”: Given only the sequence, try to predict the structure based on physico-chemical properties (energy, hydrophobicity etc.) • When all else fails works for novel folds • Shows that we understand the process The Force Field (energy function) A group of mathematical expressions describing the potential energy of a molecular system • Each expression describes a different type of physicochemical interaction between atoms in the system: • Van der Waals forces • Covalent bonds • Hydrogen bonds • Charges • Hydrophobic effects Non-bonded terms Approaches to Ab-initio Prediction 1. Molecular Dynamics • Simulates the forces that governs the protein within water. • Since proteins usually naturally fold, this would lead to the native protein structure. Problems: • Thousands of atoms • Huge number of time steps to reach folded protein feasible only for very small proteins Approaches to Ab-initio Prediction 2. Minimal Energy Assumption: the folded form is the minimal energy conformation of a protein Main principals: • Define an energy function. • Search for 3D conformation that minimize energy. Ab-initio • Current methods (e.g. Rosetta) primarily utilize the fact that although we are far from observing all protein folds, we probably have seen nearly all substructures: • A library of known sub-structures (fragments less than 10 residues) is created. • A range of possible conformations for each fragment in the query protein are selected. Moult J. Philos. Trans. R. Soc. B. 361:453–458 (2006) Ab-initio - Example Moult J. Philos. Trans. R. Soc. B. 361:453–458 (2006) Fold Recognition (Threading): Sequence to structure matching Given a sequence and a library of folds, thread the sequence through each fold. Take the one with the highest score. • Method will fail if new protein does not belong to any fold in the library. • Score of the threading is computed based on known physical chemistry properties & statistics of amino acids. • In practice, fold recognition methods are often mixtures of sequence matching and threading. Structure Prediction Approaches Threading: example Input: 1. sequence H bond donor H bond acceptor Glycin Hydrophobic 2. Library of folds of known proteins Threading: example H bond donor H bond acceptor Glycine Hydrophobic S=-2 Z= -1 S=5 Z=1.5 S=20 Z=5 Fold recognition (threading) Find best fold for a protein sequence: 1) ... 56) ... MAHFPGFGQSLLFGYPVYVFGD... -10 ... ... n) ... -123 ... 20.5 Potential fold We need a scoring (energy) function to distinguish native structure from misfolded structures. Ideally, each misfolded structure should have an energy higher than the native energy, i.e. :Emisfolded-Enative> 0 Fold recognition: FFAS03 •The FFAS03 server provides an interface to the third generation of the profile-profile alignment and fold recognition algorithm FFAS. • Profile-profile alignments utilize information present in sequences of homologous proteins to amplify the sequence conservation pattern defining the family •The result: detection of remote homologies beyond the reach of other sequence comparison methods. Jaroszewski, L., Rychlewski, L., Li, Z., Li, W. & Godzik, A. (2005) FFAS03: a server for profile-profile sequence alignments. Nucl. Acids Res. 33, W284-W288 Fold recognition: HHPRED Profiles are based on Hidden Markov Models: 0.4 0.1 0.1 0.5 0.6 0.7 0.4 0.7 0.2 0.3 0.6 Emit Amino acid Söding J. (2005) Protein homology detection by HMM-HMM comparison. Bioinformatics 21, 951-960. Fold recognition: HHPRED • Profile Hidden Markov Models (HMMs) are similar to sequence profiles, but in addition to the amino acid frequencies they contain information about the frequency of inserts and deletions. • Using profile HMMs in place of simple sequence profiles should therefore further improve sensitivity. • The first to employ HMM-HMM comparison, based on a novel statistical method. • Using HMMs both on the query and the database side greatly enhances the sensitivity and selectivity over sequence-profile based. Söding J. (2005) Protein homology detection by HMM-HMM comparison. Bioinformatics 21, 951-960. I-TASSER- Hybrid Approach • In a recent wide blind experiment, I-TASSER generated the best 3D structure predictions among all automated servers. • Based on the secondary-structure threading and the iterative implementation of the Threading ASSEmbly Refinement (TASSER) program. I-TASSER Homology Modeling Homology Modeling – Basic Idea 1. A protein structure is defined by its amino acid sequence. 2. Closely related sequences adopt highly similar structures, distantly related sequences may still fold into similar structures. 3. Three-dimensional structure of proteins from the same family is more conserved than their primary sequences. Triophospate ismoerases 44.7% sequence identity 0.95 RMSD Homology modeling requires handling structures & sequences • Query- only the protein sequence is available- usually found at the UniProt database • Template- after identification, both structural and sequencerelated data should be found- UniPort (or NCBI databases), RCSB and PDBsum Homology modelingwidespread technique Query protein sequence Identify Homologous proteinstructural template Align query & template protein sequences Build model e.g. Fiser et al., 2004; Petrey et al., 2005; Zhang, 2008 Evaluate model General Scheme 1. Searching for structures related to the query sequence 2. Selecting templates 3. Aligning query sequence with template structures 4. Building a model for the query using information from the template structures Modeller 5. Evaluating the model Fiser A et al. Methods in Enzymology 374: 461-491(2004) General Scheme 1. Searching For Structures • Sequence search against the PDB sequences • Sequence-profile search • Threading: sequence-structure fitness function 1. Searching For Structures If BLAST search against the PDB fail to recognize adequate templates, turn to fold recognition (threading) servers: • FFAS03- http://ffas.ljcrf.edu/ffas-cgi/cgi/ffas.pl • HHPRED- http://toolkit.tuebingen.mpg.de/hhpred • HMAP (available through the FUDGE pipeline)http://wiki.c2b2.columbia.edu/honiglab_public/index.php/Software: PUDGE • I-TASSER- http://zhang.bioinformatics.ku.edu/I-TASSER/ These servers not only find optional templates, but also suggest a pairwise alignment and in some cases even construct the 3D model. 2. Selecting Templates How to select the right template? • Higher sequence similarity - %ID • Close subfamily - phylogenetic tree • Seq. 1 “Environment” similarity - solvent, pH, ligand, Seq. 2 quaternary interactions Seq. 3 Seq. 4 determined Seq. 5 Seq. 6 • The quality of the experimentally structure • Purpose of modeling - e.g. protein-ligand model vs. geometry of active site 2. Selecting Templates More than one template • Two ways to combine multiple templates: – Global model – alignment with different domain of the target with little overlap between them – Local model – alignment with the same part of the target 2. Selecting Templates More than one template The more the merrier - multiple structures with the same fold: 2. Selecting Templates Trial and error • Generate a model for each candidate template and/or their combination. • Evaluate the models by an energy or any other scoring function. (will be discussed later…) 3. Aligning query and template sequences • All comparative modeling programs depend on a target-template alignment. • When the sequence similarity between the template and target proteins is high, simple pairwise alignments are usually fine (e.g. Needleman-Wunsch global alignment). • Gaps or low/medium sequence similarity indicate that we should improve the alignment... 3. Aligning query and template sequences Guidelines: 1. Create a multiple sequence alignment and extract the template-query pairwise alignment. Pairwise alignments – not enough! 3. Aligning query and template sequences Guidelines: 1. Create a multiple sequence alignment and extract the template-query pairwise alignment. Template Query • Visual inspection of alignments - difficult to teach… a matter of experience… 3. Aligning query and template sequences Guidelines: 1. Create a multiple sequence alignment and extract the template-query pairwise alignment. 2. Use secondary structure information to improve pairwise alignment- avoid gaps in these regions! Query Template 3. Aligning query and template sequences Guidelines: 1. Create a multiple sequence alignment and extract the template-query pairwise alignment 2. Use secondary structure information to improve pairwise alignment- avoid gaps in these regions! 3. Biochemical and structural previous data 3. Aligning query and template sequences Tips for MSA building • Where? (to find homologues) • Structural templates- search against the PDB • Sequence homologues- search against SwissProt or Uniprot (recommended!)- usually using BLAST • How many? • As many as possible, as long as the MSA looks good (next week…) 3. Aligning query and template sequences Tips for MSA building • How long? (length of homologues) • Fragments- short homologues (less than 50,60% the query’s length) = bad alignment • Ensure your sequences exhibit the wanted domain(s) • N/C terminal tend to vary in length between homologues • How close? (distance from query sequence) • All too close- no information • Too many too far- bad alignment • Ensure that you have a balanced collection! 3. Aligning query and template sequences Tips for MSA building • From who? (which species the sequence belongs to) • Don’t care, all homologues are welcome • Orthologues/paralogues may be helpful • Sequences from distant/close species provide different types of information • Which alignment method? • The best today are MUSCLE, T-Coffee and MAFFT. All available at 3. Aligning query and template sequences Tips for MSA building • Most importantly, make sure that both the query and the selected template are included in the MSA. • Sequences which are more distant than the template are not needed to be included in the alignment. 3. Aligning query and template sequences Query-template alignment via a profile-to-profile approach: 1. Construct an MSA for the query, serving as profiles depicting the protein family properties. 2. Align the profile to profiles of all proteins of the PDB, using, e.g., FFAS03 or HHpred. 3. Compare pairwise alignments constructed via the different methods – hope to get a consensus prediction… 3. Aligning query and template sequences Different levels of similarity between the template & query initiate various computational approaches: 4. Building a model Once you have an improved pairwise alignment between your query & template Use Modeller to build your model! A. Sali & T.L. Blundell. Comparative protein modelling by satisfaction of spatial restraints. J. Mol. Biol. 234, 779-815, 1993. 4. Building a model Modeller Generation and Refinement Using satisfaction of spatial restrains Can perform additional tasks: de novo modeling of loops Optimization of models – using an objective function Multiple alignment Comparison of protein structures 4. Building a model Modeller • Other spatial features, such as hydrogen bonds, and dihedral angles, are transferred from the templates to the target. • Thus, a number of spatial restraints on its structure are obtained. • The 3D model is obtained by satisfying all the restraints as well as possible . 4. Building a model Modeller • Distance and dihedral angle restraints on the target are calculated from its alignment with template. • Restraints were obtained also from a statistical analysis of the relationships from a large database of pairs of homologous structures. • Various correlations were obtained, e.g. correlations between CaCa distances. These relationships can be used directly as spatial restraints. • Restraints and CHARMM energy terms are then combined into an objective function, which is optimized in 3D space. 5. Model Evaluation • The accuracy of the model depends on its sequence identity with the template: 5. Model Evaluation The model can be assessed in two levels: • Global- reliability of the model as a whole. *Useful when several models are generated and one should be chosen as the best one. *When different models were based on various templates, may help choose the best one. • Local- assessing the reliability of the different regions, even specific residues, of the model. *Useful to detect local mistakes, that may originate in many time from alignment errors. 5. Model Evaluation Examples of assessment approaches: 1. Assessment of the model’s stereochemistry 2. Prediction of unreliable regions of the model “pseudo energy” profile: peaks errors 3. Consistence with experimental observations 4. Consistence with evolutionary conservation rates Summary: 5 Basic Steps Hands ON The Query Protein Name: Dihydrodipicolinate reductase Enzyme reaction: Molecular process: Lysine biosynthesis (early stages) Organism: E. coli Sequence length: 273 aa 1. Searching For Structures 1. Searching For Structures Get your sequence <DAPB_ECOLI MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAG KTGVTVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQ AIRDAAADIAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTA LAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGE RLEITHKASSRMTFANGAVRSALWLSGKESGLFDMRDVLDLNNL http://www.uniprot.org/ 1. Searching For Structures Find templates with significant homology: • BLAST against the sequences in the PDB Find also more distant templates, using profile-toprofile approach: • FFAS03 server • HHPRED server 1. Searching For Structures Blast against the PDB http://www.ncbi.nlm.nih.gov/BLAST/ 1. Searching For Structures Blast against the PDB 1. Paste sequence 2. Select the PDB database 3. http://www.ncbi.nlm.nih.gov/BLAST/ 1. Searching For Structures Blast against the PDB http://www.ncbi.nlm.nih.gov/BLAST/ 1. Searching For Structures Use fold recognition - FFAS03 1. Paste sequence Select the PDB database Run 1. Searching For Structures Use fold recognition - HHPRED http://toolkit.tuebingen.mpg.de/hhpred Select the PDB database 1. Paste sequence Run 2. Selecting templates 2. Selecting templates Blast against the PDB The real structure of our protein Closest homologous structure 2. Selecting templates Blast against the PDB The selected template: 1VM6, chain A http://www.ncbi.nlm.nih.gov/BLAST/ 2. Selecting templates Use fold recognition - FFAS03 http://ffas.ljcrf.edu/ffas-cgi/cgi/get_mu.pl?ses=&qdb=public&tdb =PDB0408&type=re&key=221830166.3750.0000000 2. Selecting templates Use fold recognition - FFAS03 Scores below -9.5 significant 2. Selecting templates Use fold recognition - HHPRED http://toolkit.tuebingen.mpg.de/hhpred/histograms/8455009 2. Selecting templates Use fold recognition - HHPRED 2. Selecting templates Who is our template? PDB ID 1VM6 is UniProt entry ‘DAPB_THEMA’ www.ebi.ac.uk/thornton-srv/databases/pdbsum 3. Alignment 3. Alignment http://consurftest.tau.ac.il/ 3. Alignment No model yet… We will use ConSurf to get homologues and build and MSA 3. Alignment Set to max- 500 Redundanc y Min. identity Alignment method Database; Swissprot/uniprot/ uniref90/NR 3. Alignment Job name Email 3. Alignment 3. Alignment PSIBLAST result Filtered sequences MSA- download the file- right click on the mouse Easiest Using Bioedit • http://www.mbio.ncsu.edu/BioEdit/BioEdit.html • Easy-to-use sequence alignment editor • View and manipulate alignments up to 20,000 sequences. •Four modes of manual alignment: select and slide, dynamic grab and drag, gap insert and delete by mouse click, and on-screen typing which behaves like a text editor. •Reads and writes Genbank, Fasta, Phylip 3.2, Phylip 4, and NBRF/PIR formats. Also reads GCG and Clustal formats Easiest Using Bioedit http://www.mbio.ncsu.edu/BioEdit/bioedit.html Easiest Using Bioedit • Find a specific sequence: “Edit-> search -> in titles” • Erase\add sequences: “Edit-> cut\paste\delete sequence” • “Sequence Identity matrix” under “Alignment”useful for a rough evaluation of distances within the alignment. • After taking out sequences, “Minimize Alignment” under “Alignment” takes out unessential gaps. • Can save an image using: “File -> Graphic View” & then “Edit -> Copy page as BITMAP” http://www.mbio.ncsu.edu/BioEdit/bioedit.html 3. Alignment Extract query-template pairwise alignment 1. Open: Start Phylogeny BioEdit 2. Open the alignment: file open ‘query.aln’ 2. Select the template: Edit Search Find in Titles “DAPB_THEMA” 3. Alignment Extract query-template pairwise alignment “DAPB_THEMA” 3. Alignment Extract query-template pairwise alignment 4. Add the query to the template selection: ctrl + ‘query’ 5. Invert selection: Edit invert title selection 6. Delete other sequences: Edit Cut Sequences(s) 7. Minimize gaps: Alignment Minimize Alignment 8. Save the pairwise alignment: File Save as (Fasta format) “DAPB_ECOLI_1VM6.fas” 3. Alignment Extract query-template pairwise alignment query DAPB_THEMA File name Save as “fasta” format!!!!!!! 3. Alignment Use fold recognition - FFAS03 Scores below -9.5 significant 3. Alignment Use fold recognition - FFAS03 http://ffas.ljcrf.edu/ffas-cgi/cgi/get_mu.pl?ses=&qdb=public&tdb =PDB0408&type=re&key=221830166.3750.0000000 3. Alignment Use fold recognition - HHPRED http://toolkit.tuebingen.mpg.de/hhpred/histograms/8455009 3. Alignment Use fold recognition - HHPRED 3. Alignment Inspect query-template pairwise alignment • Generally speaking, in this step we would compare the pairwise alignments computed by the three approaches: • MSA-derived • FFAS03 • HHPRED • We don’t have the time/patience for that now…. • Thus, we will now edit the pairwise from the MSA- Modeller requires a specific format, which we have to manually adjust 3. Alignment Edit query-template pairwise alignment The name of the query protein (this will be the name of the modeled PDB file) >P1; DAPB_ECOLI Start, end and chain sequence:DAPB_ECOLI:1:A:274:A :::: MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGV TVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAAD IAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAH ALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSR MTFANGAVRSALWLSGKESGLFDMRDVLDLNNL* The PDB file of the template >P1;1VM6 (rename DAPB_THEMA) structureX:1VM6:1:A:212:A :::: -----MKYGIVGYSGRMGQEIQKVFSE-KGHELVLKVDV-----------------------NGVEEL-DSPDVVIDFSSPEALPKTVDLCKKYRAGLVLGTTALKEEHLQMLRELSKE VPVVQAYNFSIGINVLKRFLSELVKVLE-DWDVEIVETHHRFKKDAPSGTAILLESAL-------------------GK----SVPIHSLRVGGVPGDHVVVFGNIGETIEIKHRAISR TVFAIGALKAAEFLVGKDPGMYSFEEVI-----* Save as “dapb_ecoli_1vm6.pir” 4. Model Building A script for Modeller- copy to a text file…. from modeller import * from modeller.automodel import * log.verbose() env = environ() a = automodel(env, alnfile = 'dapb_ecoli_1vm6.pir', knowns = ('1VM6'), sequence = 'DAPB_ECOLI') a.starting_model= 1 a.ending_model = 1 a.make() 4. Model Building 4. Model Building 1. Paste the template’s PDB ID “1VM6” Get the template structure 2. http://www.rcsb.org/pdb/home/home.do 4. Model Building Get the template structure: 1vm6 chain A Save as: “1VM6.pdb” Notice: case sensitive! 4. Model Building Running modeller: 1. Put the PDB file, PIR alignment and modeller script in a specific directory, e.g. c:\test 2. Desktop Modeller: 4. Model Building Running modeller: 3. “cd c:\test” 4. “mod9v7 [modeller script name] 4. Model Building Running modeller: 5. The run completed successfully: 4. Model Building Running modeller: 6. Output files: • Model, e.g. “P2RX1_HUMAN.B99990001.pdb” • Log file- very important- specifies the problems of the run • Other, not important, files 7. Open pymol and look at your model…. 8. Evaluate it- tomorrow! 4. Model Building Edit query-template pairwise alignment Watch out! Modeller can fail owing to: 1. Non-matching start and end points of the template at the PIR alignment and PDB template file 2. Small discrepancies between the sequence of the template and in the PIR alignment… may have to manually edit the alignment a little… This, and more, will be reported in the log file