* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
Download BLAST seminar
Human genome wikipedia , lookup
Protein moonlighting wikipedia , lookup
United Kingdom National DNA Database wikipedia , lookup
Expanded genetic code wikipedia , lookup
Therapeutic gene modulation wikipedia , lookup
Metagenomics wikipedia , lookup
Helitron (biology) wikipedia , lookup
Artificial gene synthesis wikipedia , lookup
Point mutation wikipedia , lookup
Genetic code wikipedia , lookup
Multiple sequence alignment wikipedia , lookup
Database searching with BLAST Outline of today’s lecture • Transfer of information • Database searching with sequences • Sequence Alignment • Scoring Matrices • Significance of alignments • BLAST • method • parameters • output Celia van Gelder CMBI UMC Radboud September 2013 Transfer of information The main topic of this course is transfer of information from a well known to a “new” system (sequence). In the protein world that leads to the questions: 1) From which protein can I transfer information 2) How do I transfer what information from where to where Today’s answer is BLAST… BLAST - Searching with sequences LAST WEEK: Searching with words (Google like) Query = word(s) Tool used: (MRS-Search, Entrez, SRS, …) TODAY: Searching with sequences Query = sequence Tool used: BLAST (MRS, NCBI, ..) Database Searching with a query sequence Purpose: To identify similarities between Your query sequence (with unknown structure and function) and Database sequences (with elucidated structures and function) If we identify similarity we can transfer information! Transfer of information to corresponding residues Your sequence: DRTGHNIPLMSTRKTYHIHIENASEERTIKLLMN is phosphorylated on one of the two serines. Which one? What is your approach? Transfer of information to corresponding residues BLAST finds two database hits that are annotated to have a phosphorylated serine. DRT-GHNIPLMSTRK-TYHIHIENASEERTIKLLMN DRR-GTTINLMTTKR-TYADELENASEDRTLLLNMN AEPIYYHL---LTKRETYHIHIENASEEKIIKIVVN “this serine is phorphorylated in a known protein from the database, so in my protein the corresponding serine is likely to be phosphorylated too”. Database searching concept – The query sequence is compared (aligned) with every sequence in the database. – High-scoring database sequences are assumed to be evolutionary related to the query sequence. – If sequences are related by divergence from a common ancestor, there are said to be homologous. Sequence Alignment A B A B gap = insertion or deletion (indel) Sequence alignment is easy: You only need three things: 1) A computer program that produces all possible alignments, and 2) A computer program that gives each alignment a score, and, the simplest, 3) A computer program that selects the highest scoring alignment from the very large number you tried. Scoring/Substitution Matrix • Scoring scheme for quality of an alignment • Contains scores for every possible amino acid substitution in a sequence alignment • For protein/protein comparisons we need a 20 x 20 matrix with scores for pairs of residues. Every cell in the matrix contains at position X, Y a score for the substitution/mutation amino acid X -> amino acid Y Scores • Positive score if corresponding amino acid residues in the two aligned sequences are identical or similar. This is a likely change. • Negative score if corresponding amino acid residues are not similar. This is an unlikely change. • The scores are numbers that you can add up. Amino Acid substitutions, some thoughts Not all 20x20 possible mutations occur equally often • Residues mutate more easily to similar ones (e.g. Leucine and Isoleucine) • Residues at surface mutate more easily • Aromatics mutate preferably into aromatics • Core tends to be hydrophobic; • Cysteines are dangerous at the surface • Cysteines in sulfur bridges (S-S) seldom mutate • Some amino acids have similar codons (for example TTT & TTC for Phe, TTA & TTG for Leu) • Etc etc PAM250 Matrix (Dayhoff Matrix) Scoring example Score of an alignment is the sum of the scores of all pairs of residues in the alignment sequence 1: TCCPSIVARSN sequence 2: SCCPSISARNT 1 12 12 6 2 5 -1 2 6 1 0 => score = 46 Scoring matrix, cntnd • When you use bioinformatics tools (BLAST, CLUSTAL, etc) the scoring matrix often is a paramater that you can choose. • Two widely used matrices (often default in the packages) PAM250 (Dayhoff et al) Based on closely similar proteins BLOSUM62 (Henikoff et al) Based on conserved regions Considered best for distantly related proteins Significance of alignment (1) When is an alignment statistically significant? In other words: How much different is the alignment score found from scores obtained by aligning a random sequence to the query sequence? Or: What is the probability that an alignment with this score could have arisen by chance? Significance of alignment (2) Database size= 200 x 106 amino acids peptide #hits A AP IAP LIAP WLIAP KWLIAP KWLIAPY KWLIAPYS 10 x 106 500 x 103 25000 1250 62,5 3,1 0,16 0,008 Sequence similarity search Question: What database sequences are most similar to (or contain the most similar regions to) my own sequence? Input: Output: Query sequence List of sequences that are similar to the query sequence BLAST • BLAST – Basic Local Alignment Search Tool • BLAST finds the highest scoring locally optimal alignments between a query sequence and all database sequences. • Very fast algorithm • Can be used to search extremely large databases • Sufficiently sensitive and selective for most purposes • Robust – the default parameters can usually be used Why use BLAST? BLAST searching is fundamental to understanding the relatedness of any favorite query sequence to other known proteins or DNA sequences. Applications include • discovering new genes or proteins • discovering variants of genes or proteins • exploring protein structure and function • Etc. It is all about transfer of information! BLAST – Algorithm Step 1: Read/understand user query sequence. Step 2: Use hashing technology to select several thousand likely candidates. Step 3: Do a real alignment between the query sequence and those likely candidate. N.B. ‘Real alignment’ is a main topic of this course. Step 4: Present result to user: list of sequences that match query sequence & their alignments Basic BLAST Algorithms Program Query Database BLASTP Protein Protein 1 BLASTN DNA DNA 1 BLASTX translatedDNA protein 6 TBLASTN protein translatedDNA 6 TBLASTX translatedDNA translatedDNA 36 DNA potentially encodes six proteins 5’ CAT CAA 5’ ATC AAC 5’ TCA ACT 5’ CATCAACTACAACTCCAAAGACACCCTTACACATCAACAAACCTACCCAC 3’ 3’ GTAGTTGATGTTGAGGTTTCTGTGGGAATGTGTAGTTGTTTGGATGGGTG 5’ 5’ GTG GGT 5’ TGG GTA 5’ GGG TAG Slide from Bioinformatics and Functional Genomics by Jonathan PevsnerCopyright © 2009 Steps in running BLAST •Entering your query sequence (cut-and-paste) •Select the database(s) you want to search And, optionally: •Choose output parameters •Choose alignment parameters (scoring matrix, filters,….) BLAST Input - FASTA format >relevant_sequence_name optional comments AFIWLLSCYALLGTTFGCGVNAIHPVLTGLSKIVNGEEAVPGTWPW QVTLQDRSGFHFCSLISEDWVVTAAHCGVRTSEILIAGEFDQGSDE DNIQVLRIAKVFKQPKYSILTVNNDITLLKLASPARYSQTISAVCLPSV DDDAGSLCATTGWGRTKYNANKSPDKLERAALPLLT BLAST Output Click here to go to the corresponding swissprot entry Click here to study alignment in detail; Look here first!! A high score indicates a likely relationship A low E-value indicates that a match is unlikely to have arisen by chance BLAST Output But remember: Mathematical significance ≠ biological significance! Low scores with high E-values suggest that matches have arisen by chance Alignment Significance in BLAST P value (probability) •A p value is a way of representing the significance of an alignment. •The closer to zero, the greater the confidence that the hit is significant. • 0<p<1 Alignment Significance in BLAST E value (expect value) •The expect value E is the number of alignments with scores greater than or equal to the current score S that are expected to occur by chance in a database search. • e.g. an E value of 5 assigned to a hit indicates that in a database of the current size one might expect to see 5 matches with a similar score simply by chance. • Rule of thumb: An E value of 10-6 or better normally means that things are OK. BLAST result: easy BLAST result: less easy BLAST result: very difficult BLAST parameter: Low complexity filter •Many sequences contain repeats or stretches that consist predominantly of one type of amino acid •We call this low-complexity regions. •Examples: • Many nuclear proteins have a poly-asparagine tail (polyN) • Huntington´s disease PolyGlutamine (polyQ) repeat • Membrane proteins often consist of mainly hydrophobic amino acids •Many binding proteins have proline rich stretches. Example PPPPPPL/R BLAST - Low complexity filter Low complexity regions influence your BLAST output NNNNNNNN Use the low complexity filter to adapt your BLAST query sequence: Filter OFF NNNNNNNN Filter ON Choice depends on your research question! Low complexity motifs visible Things we discussed today Why we want to do database searches – Transfer of information! Alignment & scoring methods Significance of alignments BLAST • principle of method • BLAST output, in particular E-value • BLAST input parameters, in particular low complexity filter Let´s BLAST!!