Evidence from glycine transfer RNA of a frozen accident at the dawn
... A37 has been replaced by G, perhaps because of a general increase in G+C content in the tRNA and rRNA of these species [18]. There are three other sequences not containing an anticodon loop CCA that appear to be isolated examples, but in these cases their origin is unclear. Schimmel's experimental w ...
... A37 has been replaced by G, perhaps because of a general increase in G+C content in the tRNA and rRNA of these species [18]. There are three other sequences not containing an anticodon loop CCA that appear to be isolated examples, but in these cases their origin is unclear. Schimmel's experimental w ...
Project 3: Visualizing Three-Dimensional Protein Structures Using
... TNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALSEGLGVIACIGEKLDEREAGI TEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRII YGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ a. ...
... TNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALSEGLGVIACIGEKLDEREAGI TEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRII YGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ a. ...
Engineering Cytosolic Acetyl-CoA Metabolism in
... In connection with biobased chemical production, it is necessary to engineer the metabolism of cell factories such that the raw material, typically sugars, can be efficiently converted to the product of interest. Although IMI076 could grow on glucose, it was still inefficient at conversion of pyruva ...
... In connection with biobased chemical production, it is necessary to engineer the metabolism of cell factories such that the raw material, typically sugars, can be efficiently converted to the product of interest. Although IMI076 could grow on glucose, it was still inefficient at conversion of pyruva ...
Fulltext - Jultika
... was taken as a model protein. MCR was purified, crystallized and the structure of unliganded protein was determined at 1.8 Å resolution using the MIRAS procedure. The structure shows that the enzyme is an interlocked dimer. To understand the reaction mechanism and the mode of substrate binding, seve ...
... was taken as a model protein. MCR was purified, crystallized and the structure of unliganded protein was determined at 1.8 Å resolution using the MIRAS procedure. The structure shows that the enzyme is an interlocked dimer. To understand the reaction mechanism and the mode of substrate binding, seve ...
A Point Mutation in Transthyretin Increases Affinity for Thyroxine and
... wt), and the resulting peptides were isolated using reverse-phase HPLC. Specific purified tryptic peptides were sequenced in a liquidphase protein sequenator, as previously described (1 1). Peptides for sequencing were selected based on DNA sequencing of exon 4 as described below. Enzymatic amplific ...
... wt), and the resulting peptides were isolated using reverse-phase HPLC. Specific purified tryptic peptides were sequenced in a liquidphase protein sequenator, as previously described (1 1). Peptides for sequencing were selected based on DNA sequencing of exon 4 as described below. Enzymatic amplific ...
Monoclonal Antibody between Cockroach Allergen Bla g 2 and a
... The use of synthetic peptides has been proven useful to identify linear B cell epitopes, especially in foods (9, 10). However, epitope mapping of globular proteins such as Bla g 2 with allergen peptides or fragments has an important limitation of missing the identification of conformational epitopes ...
... The use of synthetic peptides has been proven useful to identify linear B cell epitopes, especially in foods (9, 10). However, epitope mapping of globular proteins such as Bla g 2 with allergen peptides or fragments has an important limitation of missing the identification of conformational epitopes ...
Biochemical Journal
... (HindIII restriction site underlined). The gene fragment was digested by NdeI/HindIII and inserted into the pET-28b expression plasmid resulting in N-terminal His6 (hexahistidine)-tagged pET28b-LiCMS. The plasmid was transformed into Escherichia coli BL21(DE3) strain (Novagen) and the transformed ba ...
... (HindIII restriction site underlined). The gene fragment was digested by NdeI/HindIII and inserted into the pET-28b expression plasmid resulting in N-terminal His6 (hexahistidine)-tagged pET28b-LiCMS. The plasmid was transformed into Escherichia coli BL21(DE3) strain (Novagen) and the transformed ba ...
THE PLANT LECTINS
... • Once synthesized they are stored in protein bodies, a vacuolar organelle. • After seed germination, the proteins are completely degraded within days. • Ricin is synthesized as a prepropolypeptide containing both the A and B chains and an Nterminal signal sequence targeting it to the ER. • The prep ...
... • Once synthesized they are stored in protein bodies, a vacuolar organelle. • After seed germination, the proteins are completely degraded within days. • Ricin is synthesized as a prepropolypeptide containing both the A and B chains and an Nterminal signal sequence targeting it to the ER. • The prep ...
Malonate decarboxylase of Pseudomonas putida is composed of
... malonate decarboxylase from K. pneumoniae. The Klebsiella enzyme, however, was composed of the four subunits K (MdcA), L (MdcD), Q (MdcE), and N (MdcC) lacking MdcH [6]. There are several discrepancies between Pseudomonas enzyme and Klebsiella enzyme in point of the subunit composition and the neces ...
... malonate decarboxylase from K. pneumoniae. The Klebsiella enzyme, however, was composed of the four subunits K (MdcA), L (MdcD), Q (MdcE), and N (MdcC) lacking MdcH [6]. There are several discrepancies between Pseudomonas enzyme and Klebsiella enzyme in point of the subunit composition and the neces ...
IOSR Journal of Environmental Science, Toxicology and Food Technology (IOSR-JESTFT)
... Preventive Strategy by Safe Processing, Preservation and Handling of Food The main limiting growth factors for C. botulinum are extreme temperature, pH below 4.6, low a w, food preservatives and additives. Proper cooking and handling are important in reducing the number of C. botulinum spores in the ...
... Preventive Strategy by Safe Processing, Preservation and Handling of Food The main limiting growth factors for C. botulinum are extreme temperature, pH below 4.6, low a w, food preservatives and additives. Proper cooking and handling are important in reducing the number of C. botulinum spores in the ...
Thermodynamic and Biophysical Characterization of Cytochrome P450
... proteins. However, genetic manipulation of microsomal CYP2C5 allowed production of a soluble monomeric form of the enzyme and enabled its crystallization and structural elucidation (4). Structures of other human P450s have been determined recently by industrial and academic consortia using similar s ...
... proteins. However, genetic manipulation of microsomal CYP2C5 allowed production of a soluble monomeric form of the enzyme and enabled its crystallization and structural elucidation (4). Structures of other human P450s have been determined recently by industrial and academic consortia using similar s ...
A Comparative Study - Carlos Ibanez Lab @ KI
... Production and quantitation of recombinant NGF Genomic fragments containing the preproNGF coding sequences from the human (see Materials and Methods), rat (Whittemore et al., 1988), and chicken (Ebendal et al., 1986) NGF genes were subcloned in the expression plasmid vector pXM (Yang et al., 1986) a ...
... Production and quantitation of recombinant NGF Genomic fragments containing the preproNGF coding sequences from the human (see Materials and Methods), rat (Whittemore et al., 1988), and chicken (Ebendal et al., 1986) NGF genes were subcloned in the expression plasmid vector pXM (Yang et al., 1986) a ...
CENTRAL TEXAS COLLEGE
... Explain how two isotopes of an element are similar. Explain how they are different. k. Explain why electrons in the first electron shell have less potential energy than electrons in higher electron shells. l. Explain why strong covalent bonds and weak bonds are both essential in living organisms. m. ...
... Explain how two isotopes of an element are similar. Explain how they are different. k. Explain why electrons in the first electron shell have less potential energy than electrons in higher electron shells. l. Explain why strong covalent bonds and weak bonds are both essential in living organisms. m. ...
Hypoxia in skeletal muscles: from physiology to gene expression
... studies indicate that a number of genes involved in angiogenesis have been shown to increase by hypoxia [73]. For example, Myllyharju et al. shows an increase in mRNA expression of proteins in collagen chains such as Proα1(I), proα1(III), and α2(IV) and vertebrate collagen P4Hs I and II after hypoxi ...
... studies indicate that a number of genes involved in angiogenesis have been shown to increase by hypoxia [73]. For example, Myllyharju et al. shows an increase in mRNA expression of proteins in collagen chains such as Proα1(I), proα1(III), and α2(IV) and vertebrate collagen P4Hs I and II after hypoxi ...
Cardiac troponin I gene knockout - University of Wisconsin–Madison
... MO). An 11-kb SalI fragment from the P1 clone was isolated, subcloned, and found to contain the entire cardiac TnI gene (Figure 1A). A 2.5-kb SalI/BamHI fragment located upstream of exon 1 and a 2.2-kb BamHI fragment located downstream of exon 8 were used as the 59 and 39 homology units, respectivel ...
... MO). An 11-kb SalI fragment from the P1 clone was isolated, subcloned, and found to contain the entire cardiac TnI gene (Figure 1A). A 2.5-kb SalI/BamHI fragment located upstream of exon 1 and a 2.2-kb BamHI fragment located downstream of exon 8 were used as the 59 and 39 homology units, respectivel ...
Analysis of the genetic potential of the spongederived fungus
... lab and for introducing me into the puzzling world of polyketides. I am grateful for all suggestions that I got from him during the practical work in the lab, as well as for the writing of my thesis. Moreover, I want to thank him for his trust and unique experience in building up a laboratory togeth ...
... lab and for introducing me into the puzzling world of polyketides. I am grateful for all suggestions that I got from him during the practical work in the lab, as well as for the writing of my thesis. Moreover, I want to thank him for his trust and unique experience in building up a laboratory togeth ...
Why Sequence Alignment?
... Why Sequence Alignment? 4. Find similar sequences in a database • The commonly used BLAST and FASTA search programs have to utilize a form of an alignment to detect similar sequences to the sequence in hand • The methods employed has to be very fast, to make the search in a database containing milli ...
... Why Sequence Alignment? 4. Find similar sequences in a database • The commonly used BLAST and FASTA search programs have to utilize a form of an alignment to detect similar sequences to the sequence in hand • The methods employed has to be very fast, to make the search in a database containing milli ...
STRUCTURE-FUNCTION STUDIES OF THE CARNITINE/CHOLINE
... acid metabolism by facilitating the transfer of activated fatty acids across intracellular membranes. To understand the mechanism of these enzymes, the structure of human peroxisomal L-carnitine acetyltransferase (CAT) in complex with its substrate, L-carnitine, was determined. The structure reveale ...
... acid metabolism by facilitating the transfer of activated fatty acids across intracellular membranes. To understand the mechanism of these enzymes, the structure of human peroxisomal L-carnitine acetyltransferase (CAT) in complex with its substrate, L-carnitine, was determined. The structure reveale ...
23 Amino Acids, Peptides, and Proteins
... Dividing the amino acids into classes makes them easier to learn. The aliphatic side chain amino acids include glycine, the amino acid in which R = H, and four amino acids with alkyl side chains. Alanine is the amino acid with a methyl side chain, and valine has an isopropyl side chain. Can you gues ...
... Dividing the amino acids into classes makes them easier to learn. The aliphatic side chain amino acids include glycine, the amino acid in which R = H, and four amino acids with alkyl side chains. Alanine is the amino acid with a methyl side chain, and valine has an isopropyl side chain. Can you gues ...
Synonomy of Peptococcus glycinophilus
... The soluble cellular proteins of strains of Peptococcus magnus and Peptostreptococcus micros were examined by polyacrylamide gel electrophoresis. The protein patterns were distinctive and repeatable, and the two species could be separated readily. The protein pattern of strain ATCC 23195, the type s ...
... The soluble cellular proteins of strains of Peptococcus magnus and Peptostreptococcus micros were examined by polyacrylamide gel electrophoresis. The protein patterns were distinctive and repeatable, and the two species could be separated readily. The protein pattern of strain ATCC 23195, the type s ...
Short-Chain-Length Polyhydroxyalkanoates: Synthesis in
... P(3HB) biosynthesis in normal and eda mutant E. coli strains. When the chromosomal eda gene was deleted in recombinant E. coli, the P(3HB) concentration and content were decreased, compared with those of its parent E. coli. However, as previously reported by our group, metabolic capacities of differ ...
... P(3HB) biosynthesis in normal and eda mutant E. coli strains. When the chromosomal eda gene was deleted in recombinant E. coli, the P(3HB) concentration and content were decreased, compared with those of its parent E. coli. However, as previously reported by our group, metabolic capacities of differ ...
Advances in Chemical Protein Modification
... nonselective protein modification methods, new chemical tools to access homogeneous proteins for in vitro and in vivo applications have been developed for the modification of natural Cys, Lys, and tyrosine (Tyr) residues. Selected examples of the next generation of Lys modifications are depicted in Sch ...
... nonselective protein modification methods, new chemical tools to access homogeneous proteins for in vitro and in vivo applications have been developed for the modification of natural Cys, Lys, and tyrosine (Tyr) residues. Selected examples of the next generation of Lys modifications are depicted in Sch ...
Effects upon metabolic pathways and energy production by Sb(III
... mutant. Proteomics and transcriptional analyses showed that proteins/genes involved in Sb(III) oxidation and resistance, stress responses, carbon metabolism, cell mobility, phosphonate and phosphinate metabolism, and amino acid and nucleotide metabolism were induced by Sb(III) and were more signific ...
... mutant. Proteomics and transcriptional analyses showed that proteins/genes involved in Sb(III) oxidation and resistance, stress responses, carbon metabolism, cell mobility, phosphonate and phosphinate metabolism, and amino acid and nucleotide metabolism were induced by Sb(III) and were more signific ...
Metabolism of acyl‐lipids in Chlamydomonas reinhardtii
... a metabolic point of view, a useful distinction is to be made between lipids derived from fatty acids (FAs), which are often referred to as acyl-lipids and represent the vast majority of lipids found in cells (mostly glycerolipids and sphingolipids) and lipids that have other biosynthetic origins (e ...
... a metabolic point of view, a useful distinction is to be made between lipids derived from fatty acids (FAs), which are often referred to as acyl-lipids and represent the vast majority of lipids found in cells (mostly glycerolipids and sphingolipids) and lipids that have other biosynthetic origins (e ...
Two-hybrid screening
Two-hybrid screening (also known as yeast two-hybrid system or Y2H) is a molecular biology technique used to discover protein–protein interactions (PPIs) and protein–DNA interactions by testing for physical interactions (such as binding) between two proteins or a single protein and a DNA molecule, respectively.The premise behind the test is the activation of downstream reporter gene(s) by the binding of a transcription factor onto an upstream activating sequence (UAS). For two-hybrid screening, the transcription factor is split into two separate fragments, called the binding domain (BD) and activating domain (AD). The BD is the domain responsible for binding to the UAS and the AD is the domain responsible for the activation of transcription. The Y2H is thus a protein-fragment complementation assay.