Dear Jennifer - Ms. V Biology
... Teachers are encouraged to copy this student handout for classroom use. A Word file (which can be used to prepare a modified version if desired), Teacher Preparation Notes, comments, and the complete list of our hands-on activities are available at http://serendip.brynmawr.edu/sci_edu/waldron/. We t ...
... Teachers are encouraged to copy this student handout for classroom use. A Word file (which can be used to prepare a modified version if desired), Teacher Preparation Notes, comments, and the complete list of our hands-on activities are available at http://serendip.brynmawr.edu/sci_edu/waldron/. We t ...
IB BIOLOGY: Respiration Notes - NatronaBiology-IB2
... Glycolysis takes place in the cytoplasm (cytosol), while the citric acid (Krebs) cycle and oxidative phosphorylation take place within the mitochondria. ...
... Glycolysis takes place in the cytoplasm (cytosol), while the citric acid (Krebs) cycle and oxidative phosphorylation take place within the mitochondria. ...
BI0 120 cell and tissues
... 28. The activation phase of the glycolysis consist of A. adding phosphates, modifying sugars and forming glyceraldehyde-3-phosphate. B. oxidative steps, proton pumping, and reaction with oxygen. C. oxidation of glyceraldehyde-3-phosphate, and storage of energy. D. ATP synthesis by substrate-level ph ...
... 28. The activation phase of the glycolysis consist of A. adding phosphates, modifying sugars and forming glyceraldehyde-3-phosphate. B. oxidative steps, proton pumping, and reaction with oxygen. C. oxidation of glyceraldehyde-3-phosphate, and storage of energy. D. ATP synthesis by substrate-level ph ...
Introduction to Metabolism
... Anaerobes – Live in the absence of oxygen. Catabolize nutrients without molecular oxygen. Obligate anaerobes- are poisoned by oxygen. Facultative – Some organisms can live in either aerobic or anaerobic conditions. They are called faculatives. Examples are yeast and E. coli. III. Nitrogen All living ...
... Anaerobes – Live in the absence of oxygen. Catabolize nutrients without molecular oxygen. Obligate anaerobes- are poisoned by oxygen. Facultative – Some organisms can live in either aerobic or anaerobic conditions. They are called faculatives. Examples are yeast and E. coli. III. Nitrogen All living ...
Protein synthesis
... polypeptide chains Many polypeptide chains are covalently modified, either while they are still attached to the ribosome (cotranslational) or after their synthesis has been completed (posttranslational). These modifications may include removal of part of the translated sequence, or the covalent ...
... polypeptide chains Many polypeptide chains are covalently modified, either while they are still attached to the ribosome (cotranslational) or after their synthesis has been completed (posttranslational). These modifications may include removal of part of the translated sequence, or the covalent ...
26490 Demonstrate knowledge of the structure, properties
... before they can report credits from assessment against unit standards or deliver courses of study leading to that assessment. Industry Training Organisations must be granted consent to assess against standards by NZQA before they can register credits from assessment against unit standards. Providers ...
... before they can report credits from assessment against unit standards or deliver courses of study leading to that assessment. Industry Training Organisations must be granted consent to assess against standards by NZQA before they can register credits from assessment against unit standards. Providers ...
protein_web_notes1
... Protein is an energy-yielding nutrient composed of carbon, hydrogen, oxygen and nitrogen. The presence of nitrogen is what makes proteins different from carbohydrates and fats. Amino acids are the building blocks of protein molecules. Most proteins are made up of combinations of 20 amino acids which ...
... Protein is an energy-yielding nutrient composed of carbon, hydrogen, oxygen and nitrogen. The presence of nitrogen is what makes proteins different from carbohydrates and fats. Amino acids are the building blocks of protein molecules. Most proteins are made up of combinations of 20 amino acids which ...
Recombinant Human Neuregulin-1 (rh NRG-1)
... prevent freeze-thaw cycles. Purity: Greater than 95.0% as determined by SDS-PAGE. Endotoxicity: The endotoxin level is less than 1 EU / µg determined by LAL method. Amino acid Sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ Biological Activity: The activity measured by its ab ...
... prevent freeze-thaw cycles. Purity: Greater than 95.0% as determined by SDS-PAGE. Endotoxicity: The endotoxin level is less than 1 EU / µg determined by LAL method. Amino acid Sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ Biological Activity: The activity measured by its ab ...
Chapter 5
... can occur when atoms, ions, and molecules collide Activation energy is needed to disrupt electronic configurations Reaction rate is the frequency of collisions with enough energy to bring about a reaction. Reaction rate can be increased by enzymes or by increasing temperature or pressure ...
... can occur when atoms, ions, and molecules collide Activation energy is needed to disrupt electronic configurations Reaction rate is the frequency of collisions with enough energy to bring about a reaction. Reaction rate can be increased by enzymes or by increasing temperature or pressure ...
Functions of the Cell
... Between successive cell divisions, cells grow through the functioning of cellular metabolism. Cell metabolism is the process by which individual cells process nutrient molecules. Metabolism has two distinct divisions: catabolism, in which the cell breaks down complex molecules to produce energy and ...
... Between successive cell divisions, cells grow through the functioning of cellular metabolism. Cell metabolism is the process by which individual cells process nutrient molecules. Metabolism has two distinct divisions: catabolism, in which the cell breaks down complex molecules to produce energy and ...
Sample exam
... 14. Which molecules drawn above would you attribute the property of amphipathic. 15. Which processes below consume more energy than they produce? (consume ATP, NADPH etc ) Gluconeogenesis Glycolysis Citric acid cycle Cholesterol synthesis Pentose phosphate pathway Fatty acid oxidation Fatty acid bio ...
... 14. Which molecules drawn above would you attribute the property of amphipathic. 15. Which processes below consume more energy than they produce? (consume ATP, NADPH etc ) Gluconeogenesis Glycolysis Citric acid cycle Cholesterol synthesis Pentose phosphate pathway Fatty acid oxidation Fatty acid bio ...
Cellular Respiration Activity 9 1. The summary formula for cellular
... ATP is highly reactive at normal body temperatures and therefore difficult for cells to store for any period of time. (In the lab, ATP is usually stored at very low temperatures, for example, at –20°C.) In addition, ATP is a relatively small molecule. As a result, if cells could store high concentra ...
... ATP is highly reactive at normal body temperatures and therefore difficult for cells to store for any period of time. (In the lab, ATP is usually stored at very low temperatures, for example, at –20°C.) In addition, ATP is a relatively small molecule. As a result, if cells could store high concentra ...
Amino Acids
... • The AA sequence of a protein's polypeptide chain is called its primary structure. • Different regions of sequence form local regular secondary structures, (a-helices or -strands). • Tertiary structure is formed by packing structural elements into one or several compact globular units called domai ...
... • The AA sequence of a protein's polypeptide chain is called its primary structure. • Different regions of sequence form local regular secondary structures, (a-helices or -strands). • Tertiary structure is formed by packing structural elements into one or several compact globular units called domai ...
19_Glycolysis, aerobic oxidation of glucose
... GluT1 is seen in erythrocytes and endothelial cells; GluT3 is located in neuronal cells (has higher affinity to glucose); GluT5 – in intestine and kidneys; GluT4 - in muscles and fat cells. ...
... GluT1 is seen in erythrocytes and endothelial cells; GluT3 is located in neuronal cells (has higher affinity to glucose); GluT5 – in intestine and kidneys; GluT4 - in muscles and fat cells. ...
1 - El Camino College
... a.sugars b. bonds c. peptide bonds d. hydrogen bonds 48. The main function/s of carbohydrates is/are: a.store genetic information b.catalysis c.structure d.structure and energy 49. Molecules such as glycogen and cellulose that are formed from long chains of individual sugar molecules are called: a. ...
... a.sugars b. bonds c. peptide bonds d. hydrogen bonds 48. The main function/s of carbohydrates is/are: a.store genetic information b.catalysis c.structure d.structure and energy 49. Molecules such as glycogen and cellulose that are formed from long chains of individual sugar molecules are called: a. ...
Lab Protein and Amino Acids
... source of energy. Consequently, for good health, it is necessary to have a regular intake of protein through the diet. An animal can survive for a limited time on a diet that contains only vitamins, minerals, and proteins (no carbohydrates or lipids). But if the animal is fed a diet containing every ...
... source of energy. Consequently, for good health, it is necessary to have a regular intake of protein through the diet. An animal can survive for a limited time on a diet that contains only vitamins, minerals, and proteins (no carbohydrates or lipids). But if the animal is fed a diet containing every ...
Plasma membrane
... Enzymatic activity – proteins may be enzymes that catalyze steps in metabolic pathway Signal transduction – protein is a receptor for chemical messenger (hormone). Conformational change in protein relays message to inside of cell Intercellular joining – membrane proteins of adjacent cells join toget ...
... Enzymatic activity – proteins may be enzymes that catalyze steps in metabolic pathway Signal transduction – protein is a receptor for chemical messenger (hormone). Conformational change in protein relays message to inside of cell Intercellular joining – membrane proteins of adjacent cells join toget ...
Chapter 5: Microbial Metabolism
... 2. _________ - energy released from the transfer(loss) of electrons (oxidation) from one compound to another (reduction) is used to generate a proton gradient which is then used to make ATP 3. PHOTOPHOSPHORYLATION – sunlight causes chlorophyll to give up electrons. Energy released from the transfer ...
... 2. _________ - energy released from the transfer(loss) of electrons (oxidation) from one compound to another (reduction) is used to generate a proton gradient which is then used to make ATP 3. PHOTOPHOSPHORYLATION – sunlight causes chlorophyll to give up electrons. Energy released from the transfer ...
Chapter 3
... • Krebs cycle (citric acid cycle) – Completes the oxidation of substrates – Produces NADH and FADH to enter the electron transport chain ...
... • Krebs cycle (citric acid cycle) – Completes the oxidation of substrates – Produces NADH and FADH to enter the electron transport chain ...
Cells, tissues, membranes
... • DNA – template for synthesis of proteins • DNA – genetic information about sequence of amino acids needed for a protein. • Mitochondria generate the energy [ATP] in a cell from glucose. • Skeletal muscle has more mitochondria than epithelial cells as the muscle needs lots of ATP to function, so ne ...
... • DNA – template for synthesis of proteins • DNA – genetic information about sequence of amino acids needed for a protein. • Mitochondria generate the energy [ATP] in a cell from glucose. • Skeletal muscle has more mitochondria than epithelial cells as the muscle needs lots of ATP to function, so ne ...
Searching for Important Amino Acids in DNA
... The process of protein-DNA interaction has been an important subject of recent bioinformatics research, however, it has not been completely understood yet. DNA-binding proteins have a vital role in the biological processing of genetic information like DNA transcription, replication, maintenance and ...
... The process of protein-DNA interaction has been an important subject of recent bioinformatics research, however, it has not been completely understood yet. DNA-binding proteins have a vital role in the biological processing of genetic information like DNA transcription, replication, maintenance and ...
File
... process in anaerobic, meaning that it does not require oxygen. A glucose molecule has six carbon atoms. It is quite stable. This is, the bonds holding its atoms together are not easily broken. Because of this stability, the cell must use a small amount of energy to begin the glucose-splitting reacti ...
... process in anaerobic, meaning that it does not require oxygen. A glucose molecule has six carbon atoms. It is quite stable. This is, the bonds holding its atoms together are not easily broken. Because of this stability, the cell must use a small amount of energy to begin the glucose-splitting reacti ...
ChemGym_ForensicsAnswers
... 7. An empty pill bottle is found at a crime scene. What types of tests might be done on the body next to the pill bottle? Liquid chromatography and mass spectroscopy could be done on a variety of body fluids to check for high levels of the chemicals found in the drugs from the pill bottle. ...
... 7. An empty pill bottle is found at a crime scene. What types of tests might be done on the body next to the pill bottle? Liquid chromatography and mass spectroscopy could be done on a variety of body fluids to check for high levels of the chemicals found in the drugs from the pill bottle. ...
Biochemistry
_and_Carl_Ferdinand_Cori.jpg?width=300)
Biochemistry, sometimes called biological chemistry, is the study of chemical processes within and relating to living organisms. By controlling information flow through biochemical signaling and the flow of chemical energy through metabolism, biochemical processes give rise to the complexity of life. Over the last decades of the 20th century, biochemistry has become so successful at explaining living processes that now almost all areas of the life sciences from botany to medicine to genetics are engaged in biochemical research. Today, the main focus of pure biochemistry is in understanding how biological molecules give rise to the processes that occur within living cells, which in turn relates greatly to the study and understanding of whole organisms.Biochemistry is closely related to molecular biology, the study of the molecular mechanisms by which genetic information encoded in DNA is able to result in the processes of life. Depending on the exact definition of the terms used, molecular biology can be thought of as a branch of biochemistry, or biochemistry as a tool with which to investigate and study molecular biology.Much of biochemistry deals with the structures, functions and interactions of biological macromolecules, such as proteins, nucleic acids, carbohydrates and lipids, which provide the structure of cells and perform many of the functions associated with life. The chemistry of the cell also depends on the reactions of smaller molecules and ions. These can be inorganic, for example water and metal ions, or organic, for example the amino acids which are used to synthesize proteins. The mechanisms by which cells harness energy from their environment via chemical reactions are known as metabolism. The findings of biochemistry are applied primarily in medicine, nutrition, and agriculture. In medicine, biochemists investigate the causes and cures of disease. In nutrition, they study how to maintain health and study the effects of nutritional deficiencies. In agriculture, biochemists investigate soil and fertilizers, and try to discover ways to improve crop cultivation, crop storage and pest control.