• Study Resource
  • Explore Categories
    • Arts & Humanities
    • Business
    • Engineering & Technology
    • Foreign Language
    • History
    • Math
    • Science
    • Social Science

    Top subcategories

    • Advanced Math
    • Algebra
    • Basic Math
    • Calculus
    • Geometry
    • Linear Algebra
    • Pre-Algebra
    • Pre-Calculus
    • Statistics And Probability
    • Trigonometry
    • other →

    Top subcategories

    • Astronomy
    • Astrophysics
    • Biology
    • Chemistry
    • Earth Science
    • Environmental Science
    • Health Science
    • Physics
    • other →

    Top subcategories

    • Anthropology
    • Law
    • Political Science
    • Psychology
    • Sociology
    • other →

    Top subcategories

    • Accounting
    • Economics
    • Finance
    • Management
    • other →

    Top subcategories

    • Aerospace Engineering
    • Bioengineering
    • Chemical Engineering
    • Civil Engineering
    • Computer Science
    • Electrical Engineering
    • Industrial Engineering
    • Mechanical Engineering
    • Web Design
    • other →

    Top subcategories

    • Architecture
    • Communications
    • English
    • Gender Studies
    • Music
    • Performing Arts
    • Philosophy
    • Religious Studies
    • Writing
    • other →

    Top subcategories

    • Ancient History
    • European History
    • US History
    • World History
    • other →

    Top subcategories

    • Croatian
    • Czech
    • Finnish
    • Greek
    • Hindi
    • Japanese
    • Korean
    • Persian
    • Swedish
    • Turkish
    • other →
 
Profile Documents Logout
Upload
Dear Jennifer - Ms. V Biology
Dear Jennifer - Ms. V Biology

... Teachers are encouraged to copy this student handout for classroom use. A Word file (which can be used to prepare a modified version if desired), Teacher Preparation Notes, comments, and the complete list of our hands-on activities are available at http://serendip.brynmawr.edu/sci_edu/waldron/. We t ...
DNA Review PPT
DNA Review PPT

... What nitrogen bases are present in RNA? A, U, C, G ...
IB BIOLOGY: Respiration Notes - NatronaBiology-IB2
IB BIOLOGY: Respiration Notes - NatronaBiology-IB2

... Glycolysis takes place in the cytoplasm (cytosol), while the citric acid (Krebs) cycle and oxidative phosphorylation take place within the mitochondria. ...
BI0 120 cell and tissues
BI0 120 cell and tissues

... 28. The activation phase of the glycolysis consist of A. adding phosphates, modifying sugars and forming glyceraldehyde-3-phosphate. B. oxidative steps, proton pumping, and reaction with oxygen. C. oxidation of glyceraldehyde-3-phosphate, and storage of energy. D. ATP synthesis by substrate-level ph ...
Introduction to Metabolism
Introduction to Metabolism

... Anaerobes – Live in the absence of oxygen. Catabolize nutrients without molecular oxygen. Obligate anaerobes- are poisoned by oxygen. Facultative – Some organisms can live in either aerobic or anaerobic conditions. They are called faculatives. Examples are yeast and E. coli. III. Nitrogen All living ...
Protein synthesis
Protein synthesis

... polypeptide chains  Many polypeptide chains are covalently modified, either while they are still attached to the ribosome (cotranslational) or after their synthesis has been completed (posttranslational).  These modifications may include removal of part of the translated sequence, or the covalent ...
26490 Demonstrate knowledge of the structure, properties
26490 Demonstrate knowledge of the structure, properties

... before they can report credits from assessment against unit standards or deliver courses of study leading to that assessment. Industry Training Organisations must be granted consent to assess against standards by NZQA before they can register credits from assessment against unit standards. Providers ...
protein_web_notes1
protein_web_notes1

... Protein is an energy-yielding nutrient composed of carbon, hydrogen, oxygen and nitrogen. The presence of nitrogen is what makes proteins different from carbohydrates and fats. Amino acids are the building blocks of protein molecules. Most proteins are made up of combinations of 20 amino acids which ...
Recombinant Human Neuregulin-1 (rh NRG-1)
Recombinant Human Neuregulin-1 (rh NRG-1)

... prevent freeze-thaw cycles. Purity: Greater than 95.0% as determined by SDS-PAGE. Endotoxicity: The endotoxin level is less than 1 EU / µg determined by LAL method. Amino acid Sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ Biological Activity: The activity measured by its ab ...
Chapter 5
Chapter 5

... can occur when atoms, ions, and molecules collide  Activation energy is needed to disrupt electronic configurations  Reaction rate is the frequency of collisions with enough energy to bring about a reaction.  Reaction rate can be increased by enzymes or by increasing temperature or pressure ...
Functions of the Cell
Functions of the Cell

... Between successive cell divisions, cells grow through the functioning of cellular metabolism. Cell metabolism is the process by which individual cells process nutrient molecules. Metabolism has two distinct divisions: catabolism, in which the cell breaks down complex molecules to produce energy and ...
Sample exam
Sample exam

... 14. Which molecules drawn above would you attribute the property of amphipathic. 15. Which processes below consume more energy than they produce? (consume ATP, NADPH etc ) Gluconeogenesis Glycolysis Citric acid cycle Cholesterol synthesis Pentose phosphate pathway Fatty acid oxidation Fatty acid bio ...
Cellular Respiration Activity 9 1. The summary formula for cellular
Cellular Respiration Activity 9 1. The summary formula for cellular

... ATP is highly reactive at normal body temperatures and therefore difficult for cells to store for any period of time. (In the lab, ATP is usually stored at very low temperatures, for example, at –20°C.) In addition, ATP is a relatively small molecule. As a result, if cells could store high concentra ...
Amino Acids
Amino Acids

... • The AA sequence of a protein's polypeptide chain is called its primary structure. • Different regions of sequence form local regular secondary structures, (a-helices or -strands). • Tertiary structure is formed by packing structural elements into one or several compact globular units called domai ...
19_Glycolysis, aerobic oxidation of glucose
19_Glycolysis, aerobic oxidation of glucose

... GluT1 is seen in erythrocytes and endothelial cells; GluT3 is located in neuronal cells (has higher affinity to glucose); GluT5 – in intestine and kidneys; GluT4 - in muscles and fat cells. ...
1 - El Camino College
1 - El Camino College

... a.sugars b. bonds c. peptide bonds d. hydrogen bonds 48. The main function/s of carbohydrates is/are: a.store genetic information b.catalysis c.structure d.structure and energy 49. Molecules such as glycogen and cellulose that are formed from long chains of individual sugar molecules are called: a. ...
Lab Protein and Amino Acids
Lab Protein and Amino Acids

... source of energy. Consequently, for good health, it is necessary to have a regular intake of protein through the diet. An animal can survive for a limited time on a diet that contains only vitamins, minerals, and proteins (no carbohydrates or lipids). But if the animal is fed a diet containing every ...
Plasma membrane
Plasma membrane

... Enzymatic activity – proteins may be enzymes that catalyze steps in metabolic pathway Signal transduction – protein is a receptor for chemical messenger (hormone). Conformational change in protein relays message to inside of cell Intercellular joining – membrane proteins of adjacent cells join toget ...
Chapter 5: Microbial Metabolism
Chapter 5: Microbial Metabolism

... 2. _________ - energy released from the transfer(loss) of electrons (oxidation) from one compound to another (reduction) is used to generate a proton gradient which is then used to make ATP 3. PHOTOPHOSPHORYLATION – sunlight causes chlorophyll to give up electrons. Energy released from the transfer ...
BIOLOGY 1 QUIZ REVIEW SHEET CHAPTER 4.4
BIOLOGY 1 QUIZ REVIEW SHEET CHAPTER 4.4

... RESPIRATION BECAUSE WE ARE IN THE MITOCHONDRIA!!!! ...
Chapter 3
Chapter 3

... • Krebs cycle (citric acid cycle) – Completes the oxidation of substrates – Produces NADH and FADH to enter the electron transport chain ...
Cells, tissues, membranes
Cells, tissues, membranes

... • DNA – template for synthesis of proteins • DNA – genetic information about sequence of amino acids needed for a protein. • Mitochondria generate the energy [ATP] in a cell from glucose. • Skeletal muscle has more mitochondria than epithelial cells as the muscle needs lots of ATP to function, so ne ...
Searching for Important Amino Acids in DNA
Searching for Important Amino Acids in DNA

... The process of protein-DNA interaction has been an important subject of recent bioinformatics research, however, it has not been completely understood yet. DNA-binding proteins have a vital role in the biological processing of genetic information like DNA transcription, replication, maintenance and ...
File
File

... process in anaerobic, meaning that it does not require oxygen. A glucose molecule has six carbon atoms. It is quite stable. This is, the bonds holding its atoms together are not easily broken. Because of this stability, the cell must use a small amount of energy to begin the glucose-splitting reacti ...
ChemGym_ForensicsAnswers
ChemGym_ForensicsAnswers

... 7. An empty pill bottle is found at a crime scene. What types of tests might be done on the body next to the pill bottle? Liquid chromatography and mass spectroscopy could be done on a variety of body fluids to check for high levels of the chemicals found in the drugs from the pill bottle. ...
< 1 ... 1080 1081 1082 1083 1084 1085 1086 1087 1088 ... 1396 >

Biochemistry



Biochemistry, sometimes called biological chemistry, is the study of chemical processes within and relating to living organisms. By controlling information flow through biochemical signaling and the flow of chemical energy through metabolism, biochemical processes give rise to the complexity of life. Over the last decades of the 20th century, biochemistry has become so successful at explaining living processes that now almost all areas of the life sciences from botany to medicine to genetics are engaged in biochemical research. Today, the main focus of pure biochemistry is in understanding how biological molecules give rise to the processes that occur within living cells, which in turn relates greatly to the study and understanding of whole organisms.Biochemistry is closely related to molecular biology, the study of the molecular mechanisms by which genetic information encoded in DNA is able to result in the processes of life. Depending on the exact definition of the terms used, molecular biology can be thought of as a branch of biochemistry, or biochemistry as a tool with which to investigate and study molecular biology.Much of biochemistry deals with the structures, functions and interactions of biological macromolecules, such as proteins, nucleic acids, carbohydrates and lipids, which provide the structure of cells and perform many of the functions associated with life. The chemistry of the cell also depends on the reactions of smaller molecules and ions. These can be inorganic, for example water and metal ions, or organic, for example the amino acids which are used to synthesize proteins. The mechanisms by which cells harness energy from their environment via chemical reactions are known as metabolism. The findings of biochemistry are applied primarily in medicine, nutrition, and agriculture. In medicine, biochemists investigate the causes and cures of disease. In nutrition, they study how to maintain health and study the effects of nutritional deficiencies. In agriculture, biochemists investigate soil and fertilizers, and try to discover ways to improve crop cultivation, crop storage and pest control.
  • studyres.com © 2026
  • DMCA
  • Privacy
  • Terms
  • Report