• Study Resource
  • Explore Categories
    • Arts & Humanities
    • Business
    • Engineering & Technology
    • Foreign Language
    • History
    • Math
    • Science
    • Social Science

    Top subcategories

    • Advanced Math
    • Algebra
    • Basic Math
    • Calculus
    • Geometry
    • Linear Algebra
    • Pre-Algebra
    • Pre-Calculus
    • Statistics And Probability
    • Trigonometry
    • other →

    Top subcategories

    • Astronomy
    • Astrophysics
    • Biology
    • Chemistry
    • Earth Science
    • Environmental Science
    • Health Science
    • Physics
    • other →

    Top subcategories

    • Anthropology
    • Law
    • Political Science
    • Psychology
    • Sociology
    • other →

    Top subcategories

    • Accounting
    • Economics
    • Finance
    • Management
    • other →

    Top subcategories

    • Aerospace Engineering
    • Bioengineering
    • Chemical Engineering
    • Civil Engineering
    • Computer Science
    • Electrical Engineering
    • Industrial Engineering
    • Mechanical Engineering
    • Web Design
    • other →

    Top subcategories

    • Architecture
    • Communications
    • English
    • Gender Studies
    • Music
    • Performing Arts
    • Philosophy
    • Religious Studies
    • Writing
    • other →

    Top subcategories

    • Ancient History
    • European History
    • US History
    • World History
    • other →

    Top subcategories

    • Croatian
    • Czech
    • Finnish
    • Greek
    • Hindi
    • Japanese
    • Korean
    • Persian
    • Swedish
    • Turkish
    • other →
 
Profile Documents Logout
Upload
Created with Sketch. Student activity
Created with Sketch. Student activity

... 1. Decide in your group which lollies will be the bases (remember there are four sorts of these), the phosphate groups and the sugar. 2. Use the toothpicks and florist wire as bonds to hold parts together, just like in the real DNA molecule. A DNA molecule has two strands – how will you join the str ...
A. Nucleic Acid = polymer of nucleotides 1. nucleotide = molecule
A. Nucleic Acid = polymer of nucleotides 1. nucleotide = molecule

... A. All enzymes are proteins, made up of chains of amino acids. B. Restriction Enzymes digest DNA by “cutting” DNA between specific nucleotides (a disruption of the bond between a phosphate group and the next sugar molecule), at locations identified as recognition sequences which are approximately 6 ...
Chapter 13 Genetic Engineering
Chapter 13 Genetic Engineering

... • Gel Electrophoresis- DNA Fragments are placed in certain gel wells and an electric voltage is passed through them. • DNA molecules move toward the opposite end of the gel. • Smaller DNA fragments move faster through the gel. ...
Restriction Enzymes by Dr. Ty C.M. Hoffman
Restriction Enzymes by Dr. Ty C.M. Hoffman

... The  table  shows  just  a  sample  of  the  many  restriction  endonucleases  that  have  been  discovered  (and   the  bacterial  species  in  which  they  were  discovered).  While  restriction  endonucleases  are  naturally   used  by ...
Initiation at Class I Promoters
Initiation at Class I Promoters

... Amino acid side chains in proteins can form Hbonds to DNA bases. Critical for sequencespecific binding to DNA. ...
Document
Document

... The appropriate transcription factors are needed for expression of inserted genome to begin U3 region is the binding site for a number of cellular transcription factors A TATA box is present upstream (U3/R segments) allowing transcription initiation to begin by RNA Pol II Transcription begins at the ...
Gene Section SNAI2 (SNAIL homolog 2) Atlas of Genetics and Cytogenetics
Gene Section SNAI2 (SNAIL homolog 2) Atlas of Genetics and Cytogenetics

... conserved and divergent roles in the chick and mouse embryo. Human SNAI2 maps to the long arm of chromosome 8 (8q11.21), contains 3 exons and codes for a protein of 268bp (29KDa) with 5 zinc finger regions. This gene has been identified as downstream target of E2A-HLF oncoprotein and its expression ...
Study Guide Ch
Study Guide Ch

... 17. Why is DNA called the “code of life” or the “genetic code”? (Hint: What does it code for that is so important?) ...
Zoo/Bot 3333
Zoo/Bot 3333

... answers to questions relevant to topics we have recently been discussing in lecture. They are not in your textbooks. 1. It has been documented for many years that stress can have deleterious effects on health. A recently reported study out of the lab of a Nobel Prize winner has shown a link between ...
DNAtheDoubleHelix
DNAtheDoubleHelix

... The rungs of the ladder are pairs of 4 types of nitrogen bases. The bases are known by their coded letters --- A, G, T, and C. These bases always bond in a certain way. Adenine will only bond to thymine. Guanine will only bond with cytosine. This is known as the "Base-Pair Rule." The bases can occur ...
Lecture 3. MUTATIONS and DNA REPARATION A. Mutations have
Lecture 3. MUTATIONS and DNA REPARATION A. Mutations have

... Adaptive/inducible repair describes several protein activities that recognize very specific modified bases. They then transfer this modifying group from the DNA to themselves, and, in doing so, destroy their own function. These proteins are referred to as inducible because they tend to regulate thei ...
DNA - gcisd
DNA - gcisd

... The rungs of the ladder are pairs of 4 types of nitrogen bases. The bases are known by their coded letters --- A, G, T, and C. These bases always bond in a certain way. Adenine will only bond to thymine. Guanine will only bond with cytosine. This is known as the "Base-Pair Rule." The bases can occur ...
Eukaryotic Transcription factors: the DNA binding domain
Eukaryotic Transcription factors: the DNA binding domain

... amino acids between the Cys and His residues) and a linker between loops consisting of 7 or 8 amino acids. The amino acids in the loop bind to specific DNA sequences. MSNLPPTFGSTRQSPEDQSPPVPKELSFNGTTPSGKLRLFVCQTCTRAFARQEHLKRHER 60 SHTKEKPFSCGICSRKFSRRDLLLRHAQKLHSNCSDAAITRLRRKATRRSSNAAGSISGS 120 ...
File - Dr Hayley Siddons
File - Dr Hayley Siddons

... • Organisms are different because the proteins in their cells are different • The DNA provided the information about which amino acids make up proteins • It is the arrangement of the base pairs (A-T, C-G) which will determine the type of protein made • Sections of DNA which ‘code’ for a protein are ...
Leukaemia Section ins(5;11)(q31;q13q23) Atlas of Genetics and Cytogenetics in Oncology and Haematology
Leukaemia Section ins(5;11)(q31;q13q23) Atlas of Genetics and Cytogenetics in Oncology and Haematology

... 13-15 kb mRNA. Protein 431 kDa; contains two DNA binding motifs (a AT hook, and Zinc fingers), a DNA methyl transferase motif, a bromodomain; transcriptional regulatory factor; nuclear localisation. ...
chapter 11, 12, 13 practice questions
chapter 11, 12, 13 practice questions

... (BW). Create a Punnett square to show this relationship. B) What type of inheritance (incomplete dominance or codominance) is shown? 4. A trait controlled by 6 alleles are said to have ___ alleles. 5. The 23rd pair of chromosomes in males and females are called ___. Female = ___. Male = ___. 6. Are ...
DNA: Sample Storage - Sacramento County District Attorney
DNA: Sample Storage - Sacramento County District Attorney

... Amplified DNA from casework will be retained in frozen storage until the case has been technically and administratively reviewed. After the review process has been completed, the amplified DNA may be destroyed. NOTE: Exceptions to this process are when ...
1 - BEHS Science
1 - BEHS Science

... 15.complementary: the sequence of bases on one strand determines the sequence of bases on the other strand 16.replication: the process of synthesizing a new strand of DNA 17.helicase: enzymes that catalyze the unwinding and separation of double-stranded DNA or RNA during its replication 18.replicati ...
Molecular Genetics DNA
Molecular Genetics DNA

...  mRNA binds with ribosomes and tRNA brings in amino acids  Ribosome reads the mRNA like a reading a tape. Gene to Protein Video (Transcription & Translation ...
Genetic Technology 13.1 and 13.2 notes
Genetic Technology 13.1 and 13.2 notes

... • Purpose: to help determine which organisms will have the greatest chances of passing on desired traits. ...
1995 The diagram below shows a segment of DNA with a total
1995 The diagram below shows a segment of DNA with a total

... i. The mechanism of action of restriction enzymes ii. The different results you would expect if a mutation occurred at the recognition site for enzyme Y. ...
슬라이드 1
슬라이드 1

... events resulting in a widespread distribution of complete or partial retroviral sequences throughout the human genome. The human genome comprises approximately 8% of the human endogenous retroviruses (HERVs) and other long terminal repeat (LTR)–like elements. Most HERVs seem to have entered the geno ...
DNA
DNA

... – Smoking (lung or throat cancer, lung disease, etc) – Radiation ...
Presentations:Questions
Presentations:Questions

... Of the four techniques in inserting a gene, what is the most common way and what is one example of what scientists use to transfer the GOI? Recombinant DNA and they usually use either a plasmid from bacteria or a virus ...
5.2 Human Genetic Disorders File
5.2 Human Genetic Disorders File

... POINT > Distinguish between gene and chromosomal mutations POINT > Describe examples of genetic diseases caused by single gene mutations POINT > Identify human diseases caused by chromosomal mutations POINT > Explain Pedigree analysis ...
< 1 ... 287 288 289 290 291 292 293 294 295 ... 333 >

Zinc finger nuclease

Zinc-finger nucleases (ZFNs) are artificial restriction enzymes generated by fusing a zinc finger DNA-binding domain to a DNA-cleavage domain. Zinc finger domains can be engineered to target specific desired DNA sequences and this enables zinc-finger nucleases to target unique sequences within complex genomes. By taking advantage of endogenous DNA repair machinery, these reagents can be used to precisely alter the genomes of higher organisms.
  • studyres.com © 2026
  • DMCA
  • Privacy
  • Terms
  • Report