Survey
* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
DNA vaccination wikipedia , lookup
Polycomb Group Proteins and Cancer wikipedia , lookup
Gene therapy wikipedia , lookup
Site-specific recombinase technology wikipedia , lookup
Therapeutic gene modulation wikipedia , lookup
Artificial gene synthesis wikipedia , lookup
Adeno-associated virus wikipedia , lookup
Mir-92 microRNA precursor family wikipedia , lookup
Gene therapy of the human retina wikipedia , lookup
How waves of innovation in biotechnology shaped a small business venture. Chris Kemp Kempbio, Inc. 5119 Pegasus Ct. Suite P. Frederick, MD 21704 PrincetonInternational SchoolofMathematics andScience December 9,2016 A Riddle for You When do multiplication and division mean the same thing? When You are Studying Biology! POP QUIZ ! POP Quiz ! • Name Three Profoundly Destabilizing Scientific Ideas from the 20th Century – Transformed culture, language, politics and society • Hint #1 – One was from chemistry/physics – One dealt with information – One was from Biology POP Quiz ! • Name Three Profoundly Destabilizing Scientific Ideas from the 20th Century – Transformed culture, language, politics and society • Hint #1 – One was from chemistry/physics – One dealt with information – One was from Biology • Hint #2 – All are basic “building blocks” – All are the least divisible unit of a larger form POP Quiz: Answer • The Atom (matter) • The Byte (digitized information) • The Gene (biological information) Taken from: The Gene An Intimate History by Siddhartha Mukherjee How waves of innovation in biotechnology shaped a small business venture. Chris Kemp Kempbio, Inc. 5119 Pegasus Ct. Suite P. Frederick, MD 21704 PrincetonInternational SchoolofMathematics andScience December 9,2016 Kempbio, Inc. 5119 Pegasus Ct. Suite P Frederick, MD 21704 USA www.kempbioinc.com History • Kempbio, Inc. founded December 2008 at FITCI – FITCI = Frederick Technology Incubator • Graduated FITCI September 2012 • Built-out 3000 sq.ft. facility at Westview Business Park, Frederick 2012 with 7-year lease • Past employees of Kemp Biotechnologies, Inc. – 1992 to 2007 (Sold in 2006) – GeneChoice 2000 to 2008 (Sold in 2006) • 20+ years of experience working as a CRO for the Biopharmaceutical industry • Private company located in Frederick, MD Personnel • • • • • • Chris Kemp, Ph.D., President April Birch, B.S., Director of Cell Culture Heather Allen, B.S., Sr. Scientist Cell Culture Pat Kemp, B.S., Vice President Kerrie Kenefick, B.S., Purification Technician Gary Bechanan, CPA, Comptroller Company Information • 72 Customers – – – – 3 Large Pharma 4 US Government Agencies 5 Academic Institutions 60 Biopharms and Biotechnology Companies Facility • Kempbio, Inc. is located in Frederick, MD USA Protein Purification Lab • Kempbio, Inc. has 2,000 sq. ft. of laboratory space Main Lab • Kempbio, Inc. has 2,000 sq. ft. of laboratory space Main Lab • Kempbio, Inc. has 2,000 sq. ft. of laboratory space 100L SUB Kempbio’s Business Production of Proteins From Genes Kempbio is a Gene to Protein Company Gene to Protein Concept Gene to Protein Reality • >Contig pCI-X-His Sequence • ATCACAGTTAAATTGCTAACGCAGTCAGTGCTTCTGACACAACAGTCTCGAACTTAAGCTGCAGAAGTTGGTCGTGAGGCACT GGGCAGGTAAGTATCAAGGTTACAAGACAGGTTTAAGGAGACCAATAGAAACTGGGCTTGTCGAGACAGAGAAGACTCTTGC GTTTCTGATAGGCACCTATTGGTCTTACTGACATCCACTTTGCCTTTCTCTCCACAGGTGTCCACTCCCAGTTCAATTACAGCTC TTAAGGCTAGAGTACTTAATACGACTCACTATAGGCTAGCGCCACCATGGGATGGTCCTGCATCATTCTGTTCCTGGTGGC AACTGCAACCGGAGCACACAGCTCCACTGAGGAACTGTTTAAGGAGTACAAACTGACCCGACCTTATATGGCCCGGTG CATCAGATGTGCTGTGGGCTCCTGTCACTCTCCAATCGCTATTGAAGCAGTGAAGTCTGACGGGCATGATGGATACGT CCGCCTGCAGACCTCTAGTCAGTATGGCCTGGACTCAAGCGGCAACCTGAAGGGGAGGACAATGCGCTACGATATGCA CGGGACTATCAAAGAGATTCCTCTGCACCAGGTGAGTCTGCATACATCAAGACCATGCCACATCGTCGACGGACATGG CTATTTCCTGCTGGCAAGGTGTCCAGCAGGCGACTCTATTACCATGGAGTTTAAGAAAGATAGTGTGACACACAGCTGC TCCGTGCCCTACGAGGTCAAGTTCAACCCTGTCGGCAGGGAACTGTATACCCACCCCCCTGAGCATGGGGTGGAACAG GCTTGTCAGGTCTACGCCCACGACGCTCAGAATCGCGGAGCATATGTGGAGATGCATCTGCCTGGCTCTGAAGTGGAT TCCTCTCTGGTCTCTCTGAGTGGGAGTTCAGTGACAGTCACTCCACCCGTGGGAACAAGTGCCCTGGTCGAGTGCGAA TGTGGCGGGAAGAAAATCTCAGAGACTATTAATAGAACCAAGCAGTTCTCCCAGTGCACTAAGAAAGAACAGTGTCGA GCATACCGGCTGCAGAACGACAAATGGGTGTATAATAGCGATAAGCTGCCCAAAGCCGCTGGGGCTACCCTGAAGGGA AAACTGCACGTGCCCTTTCTGCTGGCAGACGGGAAGTGCACAGTCCCTCTGGCCCCCGAGCCTATGATCACTTTCGGA TTTCGCTCAGTGAGCCTGAAGCTGCATCCAAAAAACCCCACTTACCTGACCACACGACAGCTGGCCGATGAGCCACAC TATACCCATGAGCTGATTTCCGAACCCGCTGTGCGGAACTTCACCGTCACAGAGAAGGGCTGGGAATTCGTGTGGGGG AATCACCCTCCAAAAAGATTTTGGGCTCAGGAGACAGCACCTGGAAATCCACACGGCCTGCCACATGAAGTGATCACC CACTACTATCATCGGTACCCCATGAGCACAATTCTGGGCCTGTCCCACCATCACCATCACCATTAATGAGCGGCCGC • • • • >Predicted protein sequence (397 aa, MW=44,336.58) MGWSCIILFLVATATGAHSSTEELFKEYKLTRPYMARCIRCAVGSCHSPIAIEAVKSDGHDGYVRLQTSSQYGLDSSGNLKGRTMRY DMHGTIKEIPLHQVSLHTSRPCHIVDGHGYFLLARCPAGDSITMEFKKDSVTHSCSVPYEVKFNPVGRELYTHPPEHGVEQACQVYA HDAQNRGAYVEMHLPGSEVDSSLVSLSGSSVTVTPPVGTSALVECECGGKKISETINRTKQFSQCTKKEQCRAYRLQNDKWVYNSD KLPKAAGATLKGKLHVPFLLADGKCTVPLAPEPMITFGFRSVSLKLHPKNPTYLTTRQLADEPHYTHELISEPAVRNFTVTEKGWEF VWGNHPPKRFWAQETAPGNPHGLPHEVITHYYHRYPMSTILGLSHHHHHH Promega pCi Vector Basic Methods of Gene Transfer Gene to Protein Reality How waves of innovation in biotechnology shaped a small business venture. Chris Kemp Kempbio, Inc. 5119 Pegasus Ct. Suite P. Frederick, MD 21704 PrincetonInternational SchoolofMathematics andScience December 9,2016 INNOVATION • The introduction of something new • A new idea, method or device INNOVATION • The introduction of something new • A new idea, method or device Innovation Paradox: WSJ 12-9-16 TRUE INNOVATION • 1977 Herbert Boyer clones the gene for human insulin into E. coli and expresses the recombinant peptide hormone TRUE INNOVATION • • • • 1958 BS St. Vincent College LaTrobe, PA 1963 PhD University of Pittsburgh Post-Doc at Yale, Asst. Prof at UCSF 1976 Co-founded Genentech Innovations That Guide Kempbio • ViroCyt Virus Counter • BacMam Baculovirus Plaque Titer Method • • • • • • Perform serial 10X dilutions Overlay with agarose Incubate 7 Days Stain with Neutral Red Dye Count Plaques and correct for dilution Endpoint is infectious titer – Plaque Forming Unit (pfu) Rapid Virus Titer Methods • Plaque Titer (not a rapid method) • Expression Systems Flow Cytometry • Clontech BacPAK™ Rapid Titer Methods – Immunoassay – qPCR • Izon particle counter • ViroCyt virus particle counter ViroCyt Virus Counter Virus Counter part of a collaboration with ViroCyt Virus Counter (ViroCyt, LLC) • A flow cytometer-based system developed specifically to quantify viruses using a dual fluorescence staining approach • With this “Combo Dye” system, viral genomes and surface proteins are stained with fluorogenic dyes that emit in the yellow and red regions of the visible spectrum, respectively • Fluorescence emission is detected in two separate optical channels where optical compensation hardware and software elements correct for any crosstalk between channels Virus Counter (ViroCyt, LLC) • When voltage pulses are simultaneously observed in both the nucleic acid and protein emission channels, the “simultaneous event” is counted as an intact virus particle • The number of simultaneous events counted during the analysis time is used in combination with sample flow rate to calculate the concentration of virus particles per milliliter of sample Intact Virus Particles Scatter Plot: Plaque Titer vs ViroCyt vp/mL titer r2 = 0.95 Slope = 0.025 pfu/mL per vp/mL Y-intercept = -3.7x106 pfu/mL 1.20E+08 1.00E+08 pfu/mL 8.00E+07 6.00E+07 4.00E+07 2.00E+07 0.00E+00 0.00E+00 1.00E+09 2.00E+09 vp/mL (ViroCyt) 3.00E+09 4.00E+09 Virus Production based on Plaque and ViroCyt Titers MOI = 0.02 1x106 cells per mL SF900-III A = Plaque Titer B = ViroCyt Titer 7.00E+09 Virus Particles per mL 6.00E+09 5.00E+09 4.00E+09 591 A 591 B 3.00E+09 751 A 751 B 2.00E+09 1.00E+09 0.00E+00 0 20 40 60 80 Time Post-Infection (hours) 100 120 Baculovirus in Supernatant of Stirred-tank Bioreactor 3.00E+09 Virus Particles per mL 2.50E+09 Sf9 Cells MOI = 2.0 Cell Density = 2x106 cells per mL Titers by ViroCyt 2100 Each point = Mean of 3 titers 2.00E+09 1.50E+09 1.00E+09 5.00E+08 0.00E+00 0 20 40 60 80 Time Post-Infection (Hours) 100 120 Baculovirus Particles in Culture Supernatant 2.50E+09 Virus Particles per mL 2.00E+09 1.50E+09 High Five Sf9 1.00E+09 5.00E+08 0.00E+00 24 36 48 Elapsed Time (h.) 60 72 Innovations That Guide Kempbio • ViroCyt Virus Counter • BacMam Basic Methods of Gene Transfer BacMam Invitrogen 2008 • Mammalian CMV Promoter • Express rProteins in a variety of mammalian cells using a baculovirus as the delivery vehicle BacMam Transfer Vector Second Generation Bacmam Vectors VSV-G Coat Protein (Panels C-G) on envelope of budded virus allows increased entry into cells Rick Boyce 2011 GFP BacMam HEK-293 BacMam Protocol CHO and HEK • For 1L- 100L expression – Cells at 1.5 to 2x106 cells per mL for HEK-293 – Up to 4x106 cells per mL for CHO-S – Generate BacMam virus in Sf9 cells • If >10% culture volume concentrate virus • Determine virus titer using ViroCyt 3100 to determine if need concentration – Add cells and incubate at 37°C + 5% CO2 for 72-144h. – Add 10 mM sodium butyrate (required for CHO, optional for HEK) • Media formulations that work with BacMam – LTC: Freestyle-CHO, Freestyle-293 – Expression Systems: ESF SFM, ESF 921 Effect of Cell Density & MOI on rIgG Yield Cell Density: A = 2x106 cells per mL B = 3x106 cells per mL C = 4x106 cells per mL CHO-S/CD-CHO MOI = 50 (25:25) IgG B Bacmam MOI: Various mg Purified IgG per Liter 160 140 120 CHO-S/CD-CHO 4x106 cells per mL 100 80 60 40 20 0 0 10 20 30 40 BacMam MOI 50 60 1L Shake-Flask MOI = 50 96h. PT Harvest Purified Yield = 150 mg/L Humanized rIgG: 10L Bioreactor SDS PAGE Gel Coomassie Stained Non-Reduced Culture Supernatant Serum-Free Freestyle Medium HEK-293/MOI = 50 24, 48, and 72h. Post-Transduction 10-Liter Stirred-Tank Bioreactor Purified Yield = 140 mg/L Total Yield: 1.4 Grams rIgG BacMam H7N1 VLPs Medigen 2014 BacMam H7N1 VLPs • First Attempt – Ratio of H7:N1:gag was 1:1:1 – Fresh Virus Tittered using the ViroCyt 2100 – MOI was 10:10:10 (30 Total) • HEK-293 Shake-Flask 1L – Harvested supernatant at 120h. PT – Purified by centrifugation – Analyzed by TEM BacMam H7N1 VLPs Medigen 2014 BacMam H7N1 VLPs • Second Attempt – Ratio of H7:N1:gag was 1:1:0.5 – Fresh Virus Tittered using the ViroCyt 2100 – MOI was 14:14:7 (35 Total) • HEK-293 Shake-Flask 1L – Harvested supernatant at 120h. PT – Purified by centrifugation – Analyzed by TEM BacMam H7N1 VLPs Medigen 2014 Basic Methods of Gene Transfer Ebola Classification Family: Filoviridae Genus: Ebolavirus Species: 1. Zaire ebolavirus 2. Sudan ebolavirus 3. Tai Forest ebolavirus 4. Bundibugyo ebolavirus 5. Reston ebolavirus http://www.rcsb.org/pdb/101/motm.do?momID=178 Ebola Zaire Glycoprotein • Mayinga Zaire Strain – 1976 • Trimeric transmembrane protein • Heavily glycosylated • Mucin domain • Transmembrane domain deleted = dTM – MW ~120 kDa http://www.rcsb.org/pdb/101/motm.do?momID=178 • Expressed as secreted product in HEK-293 Total Ebola Cases 2014-2015 http://www.cdc.gov/vhf/ebola/outbreaks/2014-west-africa/index.html Ebola Outbreak 2014-2015 http://www.cdc.gov/vhf/ebola/outbreaks/2014-west-africa/index.html Zaire-dTM Vector Comparison PEI Vector BacMam Vector • • • • • • • • pCi Transient Expression Vector CMV Promoter HA-Tag Synthetic Gene Human Signal Sequence Transmembrane domain deleted Codon Optimized for Human Cells Gateway Entry Vector – Synthesized in standard cloning vector with ATT sites flanking ORF – Bacmid transfected into Sf9 for BacMam generation • • • • CMV Promoter Transmembrane domain deleted Human Signal Sequence Codon Optimized for Human Cells 1-Liter Z-dTM PEI and BacMam • HEK-293 Cells • 1x1000 mL flasks – Duplicate loadings • • • • • • • 1.5x106 cells per mL Freestyle, serum-free PEI: 4:1 ratio with DNA PEI: 1 mg DNA per L PEI: Harvest 96h. PT BacMam: MOI = 50 BacMam: Harvest 72h. PT Load concentrated Q-capture pool onto S-200 Sephacryl column Buffer = PBS Flow = 0.5 mL per min. Run SDS PAGE Pool ZdTM fractions Concentration and QC 10mL QSepaharose/L Batch Bind 16h. Pack Column Wash Elute using linear gradient 50-250 mM NaCl at pH 7.0 Size-Exclusion Q Capture Step Z-dTM Purification Scheme: 1-40-liters Concentrate using Centricon 10kDa MWCO Sterile Filtration Vialing Coomassie-stained SDS PAGE and Western Blot (antiZdTM Z-dTM PEI: Q-Sepharose • • • Q-Sepharose FF 20 mM Tris pH 7 Linear Gradient – 50-250 mM NaCl • • 5 mL Fractions SDS PAGE – Coomassie-stained Z-dTM BacMam: Q-Sepharose • • • Q-Sepharose FF 20 mM Tris pH 7 Linear Gradient – 50-250 mM NaCl • • 5 mL Fractions SDS PAGE – Coomassie-stained Z-dTM PEI: S-200 SEC • Sephacryl S-200 – 16/60 • • • • PBS pH 7.4 0.5 mL per min. 3 mL Fractions SDS PAGE – Coomassie-stained Z-dTM BacMam: S-200 SEC • Sephacryl S-200 – 16/60 • • • • PBS pH 7.4 0.5 mL per min. 3 mL Fractions SDS PAGE – Coomassie-stained Z-dTM BacMam and PEI Final SDS PAGE • • • PEI Yield = < 0.5 mg/L BacMam Yield = 4 mg/L SDS PAGE – Coomassie-stained – Reduced • Western Blot – Anti-ZdTM – BCIP/NBT Color Development Z-dTM BacMam and PEI Final Western Blot • • • PEI Yield = < 0.5 mg/L BacMam Yield = 4 mg/L SDS PAGE – Coomassie-stained – Reduced • Western Blot – Anti-ZdTM – BCIP/NBT Color Development Some Parting Thoughts Some Parting Thoughts Some Parting Thoughts Thanks • To Adam for the Invitation • To Everyone for Your Attention • Kempbio, Inc. – – – – April Birch Heather Allen Kerrie Kenefick Pat Kemp • Medigen (Infuenza VLP) – Peter Pushko – Irina Tretyakova