Survey							
                            
		                
		                * Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Journal o f General Virology (1992), 73, 3079-3086. 3079 Printed in Great Britain Distinct signals in human immunodeficiency virus type 1 Pr55 necessary for RNA binding and particle formation Jeremy B. M. Jowett, l t David J. Hockley, 2 Milan V. Nermut 2 and Ian M. Jones 1. 1NERC Institute of Virology, Mansfield Road, Oxford OX1 3SR and 2National Institute for Biological Standards and Control, Blanche Lane, South Mimms, Potters Bar, Hertfordshire EN6 3QG, U.K. The human immunodeficiency virus type 1 (HIV-1) gag gene product Pr55 self-assembles to form virus-like particles when expressed in Spodopterafrugiperda cells using recombinant baculoviruses. The particles resemble immature HIV and are released from the infected cell into the culture medium. Using this system we have progressively truncated the gag open reading frame from the C terminus and examined each deleted gag protein for its particle-producing capability. We show that deletion of Pr6 and deletions that progressively remove the distal region of the Pr7 domain, including one Cys-His box thought to function as an RNA capture signal, do not affect particle formation. However deletion of two Cys-His boxes causes production of slightly larger particles with altered sedimentation properties. Sequence-specific North- Western assays using an RNA probe representative of the HIV-1 packaging signal revealed specific R N A binding by all mutants that maintained both Cys-His boxes. However, deletion of one Cys-His box reduced RNA binding substantially and loss of two Cys-His boxes abolished binding entirely. We conclude that HIV-1 gag particle formation per se does not require viral R N A encapsidation, but that it may act as a cofactor in the condensation of the immature core. Further deletion of gag sequences upstream of the CysHis boxes led to the abolition of particle-forming ability, and we show that one boundary of the gag sequence necessary for particle formation lies within eight amino acids spanning one of the known protease cleavage sites at the C terminus of Pr24. Introduction larger (Prl60) gag-pol fusion protein which is also packaged into forming virions (Jacks et al., 1988). In this way, the enzymatic functions necessary for virus infectivity (the protease, reverse transcriptase, RNase H and integrase) are incorporated into the budding particle. When expressed alone in a number of eukaryotic expression systems, Pr55 produces virus-like particles very similar to the early budding immature particles seen in HIV-infected cells (Gheysen et al., 1989; Karacostas et al., 1989; Overton et al., 1989; Hu et al., 1990; Luo et al., 1990; Shioda & Shibuta, 1990; Smith et al., 1990; Haffar et al., 1991 ; Hoshikawa et al., 1991 ; Royer et al., 1991 ; Mergener et al., 1992). The ability of similar core antigens from other retroviruses to self-assemble into particle structures is now well documented (Delchambre et al., 1989; Rasmussen et al., 1990; Morikawa et al., 1991). Pr55 is normally a myristylated protein and when myristylation occurs, particles bud from the cell surface. Lack of myristylation (by mutagenesis of the N terminus of Pr55) does not affect particle formation, but does prevent particle budding and release (Gheysen et al., 1989; Overton et al., 1989). The human immunodeficiency virus (HIV) groupspecific antigen (gag) gene product represents the major component of the virus particle. It is first synthesized as a precursor protein of 55K (Pr55) and forms the structural basis of the retrovirus core. During or following virus release, Pr55 is cleaved by the viral protease to yield three gag-related components, Prl7 (also known as MA protein), Pr24 (also known as CA) and Prl5 (also known as NC protein) (for reviews see Kieny, 1990; Wills & Craven, 1991). The Prl5 molecule undergoes further cleavage to Pr7 (sometimes known as Pr9) and Pr6 (Veronese et al., 1987, 1988), and low frequency internal initiation within the Pr55 open reading frame can result in the production of a Pr41gag product of unknown significance (Mervis et al., 1988). At a rate of about 5 %, ribosomes translating the gag m R N A undergo a frameshift event near the Pr7/Pr6 junction, resulting in the deletion of the Pr6 domain and the production of a much t Present address: Department of Microbiology, UCLA School of Medicine, Los Angeles, California 90073, U.S.A. 0001-1173 © 1992 SGM Downloaded from www.microbiologyresearch.org by IP: 88.99.165.207 On: Fri, 16 Jun 2017 23:40:03 3080 J. B. M . J o w e t t and others In contrast to Pr55, the expression of permanently frameshifted gag-pol fusion protein does not allow particle formation (Shioda & Shibuta, 1990; Mergener et al., 1992), a result which is in keeping with earlier work using other retroviruses (Felsenstein & Goff, 1988). This might suggest a role for Pr6 in particle formation or release because gag-pol fusions lack the gag Pr6 domain. Indeed, truncations of the Pr6 domain within H I V proviral clones have been reported to allow particle formation but to prevent virion release from infected cells (Gottlinger et al., 1991). However, equivalent deletions in a vaccinia virus expression system producing solely gag antigen allow particle formation and release (Hoshikawa et al., 1991). However, in this case, there is the possibility that vacinia virus itself contributes a function that can substitute for the missing Pr6 domain. Pr55 is a multifunctional protein and, in addition to driving particle formation and the co-incorporation of gag-pol fusion proteins, it is also responsible for the capture and incorporation into the core of the viral genomic R N A . This function resides in the gag Pr7 domain and is associated with two Cys-His motifs thought to function as the R N A capture signal. Point mutations within these motifs reduce R N A incorporation and virus infectivity (Clavel & Orenstein, 1990; Gorelick et al., 1990). Expression of gag proteins lacking the Pr7 domain prevents particle formation (Gheysen et al., 1989; Hoshikawa et al., 1991) suggesting that, in addition to R N A binding, the essential signals for gaggag interaction also lie within, or very close to, Pr7. This result has been taken to suggest a link between R N A binding and particle formation (Gelderblom, 1991). Intriguingly, mutations in H I V genomic R N A that lead to poor genome incorporation also result in particles with altered morphology (Clavel & Orenstein, 1990) and, in other systems, a direct role for Cys-His boxes in subunit interaction as well as nucleic acid-binding has been demonstrated (Loeber et al., 1991). Moreover, from a virus point of view, a link between successful R N A capture and particle formation could be beneficial, helping to minimize the formation of empty virus particles. To localize the sequences necessary for particle formation in finer detail, and to investigate the association with R N A binding, we have expressed a detailed series of gag truncation mutants and assessed their ability to form and release particles, and to bind H I V RNA. Methods DNA manipulation. Routine manipulations of DNA, plasmid preparation, restriction digests and subcloning were all as described (Sambrooket aL, 1989). Gag gene truncations Pr45, Pr44 and Pr42 were all prepared by site-directed mutagenesis as described by Kunkel (1985) using the followingoligonucleotides:for Pr45, 5' GCCTGTCTCTAAGTACAATCT3'; for Pr44, 5' CAACAGCCCTATTTCCTAGGG 3'; for Pr42, 5' TTGAAACACTAAACCATCTTT3'. Genes encoding truncations Pr41.5 and Pr41 were made by the polymerase chain reaction (PCR) using the forward primer 5' CGCGGAGCTCAG A G A T G G G T G C G A G A G C G T C 3' and reverseprimers as follows: for Pr41.5, 5' CGCGTCTAGACTATGTATTTGTTACTTGGCTCAT 3' and for Pr41, 5' CGCGTCTAGACTACAAAACTCTTGCCTTATGGC 3'. Amplified products were eluted from a gel, cleaved with SacI and XbaI, and cloned into the baculovirus transfer vector pAcCL29.1 (Livingstone & Jones, 1989). All mutants and PCR products were sequenced prior to their use for expression. Selection of recombinant baculoviruses was done using linearized baculovirus DNA as described (Kitts et al., 1991). Cells and viruses. Spodopterafrugiperda (Sf9) cellswere propagated at 28 °C in TC-100 medium (Overton et al., 1989)containing 10% foetal calf serum. AcNPV-Bgal, AcPAK6 (for transfections) and recombinant viruses were grown and assayed in confluentmonolayersof Sf9 cells as described (Summers & Smith, 1987). RNA binding. RNA binding by each gag mutant was assayed by North-Western blotting under the conditions described by Luban & Goff(1991). The probe was prepared by in vitro transcription of an HIV fragment spanning nucleotides 675 (a SacI site) to 840 (an XmnI site) of HIV-ILAI. Non-specific probe was transcribed from the negative strand. Electron microscopy. For negative staining, Sf9 cells infected with each of the truncated gag mutants were harvested 2 days post-infection, washed once in PBS and fixed in 2.5% glutaraldehyde in 0-1 Mcacodylate bufferpH 7.2 for at least 24 h. Fixed cellswere embedded in 1% low meltingpoint agarose, and the agarose blockswere brieflyfixed in glutaraldehyde and washed in cacodylatebufferbefore being treated with 1% osmium tetroxide (in cacodylate buffer) for 2 h and 0.5% uranyl acetate for a further 3 h. After dehydration in ethanol, cellswere embedded via propylene oxide in Araldite. Sections were cut with a diamond knife on a Reichert-Jung Ultracut E ultramicrotome, poststained with uranyl acetate and lead citrate, and examined with a Philips CM12 electron microscope operating at 80 kV. Results Expression o f truncated gag antigens The initial series of gag deletion mutants used in this study is shown in Fig. 1. For the first construct (Pr46) the S a c I - B g l l I fragment spanning most of the gag O R F of HIV-1LA~ was cloned into the baculovirus expression vector pAcCL29.1 (Livingstone & Jones, 1989). This fragment encodes the gag precursor protein up to and including the frameshift signal, but the protein is deleted downstream of amino acid 437 (the Pr6 domain). Three further mutations truncating the upstream Pr7 domain were prepared in the same expression vector by sitedirected mutagenesis, introducing a stop codon (TAG) at the position shown. These three mutations resulted in the deletion of the gag O R F downstream of (i) amino acid 427 (just downstream of the Cys-His boxes), (ii) amino Downloaded from www.microbiologyresearch.org by IP: 88.99.165.207 On: Fri, 16 Jun 2017 23:40:03 HIV-1 Pr55 RNA-binding signals / p24 l ~ ~ p6 3081 (b) 1 2 3 4 5 6 7 1 2 3 4 5 6 7 116K-84K - 58K-48K - I ! l 36K Pr55 Pr46 Pr45 Pr44 Pr42 (437) (427) (410) (390) Cys-His motif Fig. 1. Construction of gag truncation mutants. The position of each mutant made is shown in relation to the Y-terminal end of the gag ORF. The SacI-BglII fragment of HIV'ILAI was cloned directly into a baculovirus transfer vector to produce Pr46 which encodes a protein deleted downstream of amino acid 437. Site-directed mutation introduced a stop codon at codons 427, 410 and 390, producing constructs Pr45, Pr44 and Pr41, respectively. The position of the CysHis boxes in relation to the mutations is shown. 24K - Fig. 2. Expression of gag truncations and reactivity with anti-gag MAbs. Recombinant viruses were grown to high titre and used to infect Sf9 cells at a multiplicity of 10. Two days post-infection cells were washed, lysed and fractionated on 10% SDS-polyacrylamide gels. Gels were either stained directly with Coomassie blue (a) or transferred to nitrocellulose and incubated with gag-specific MAbs (b). Lane 1, Pr55; 2, Pr46; 3, Pr45; 4, Pr44; 5, Pr42; 6, wild-type baculovirus-infected; 7, mock-infected. M~s were taken from pre-stained standards run at the same time. Fraction no. acid 410 (between the two Cys-His boxes) and (iii) amino acid 390 (just before the Cys-His boxes). Based on the sequence changes made, these mutants were predicted to encode proteins of Mr 45K, 44K and 42K and were named accordingly (Fig. 1). All mutations were confirmed by sequence analysis before their co-transfection into cells with viral DNA to yield recombinant baculoviruses (Kitts et al., 1991). Recombinant viruses producing gag protein were screened for and identified by Western blotting with a mix of monoclonal antibodies (MAbs) reactive with HIV gag Prl7 and Pr24 antigens. Plaque-purified mutant viruses from each transfection were then used to infect a culture of Sf9 cells at a multiplicity of 10, and the cultures were harvested 2 days post-infection and examined by SDS-PAGE and Western blotting (Fig. 2). Cell lysates from each truncation mutant produced stainable quantities of a new protein (a) at a mobility corresponding to the predicted Mr of the gag protein. Each gag protein was also stained specifically with anti-gag MAbs (b). Wildtype virus-infected (lane 6) or mock-infected cells (lane 7) showed no evidence of any cross-reactive material. Wildtype Pr55 protein (lane 1) exhibited some breakdown, as described previously (Gheysen et al., 1989), but the truncation mutants showed much less breakdown suggesting that the majority of cellular proteases cleave from the C terminus of gag. Particle formation and release To assess the ability of each of our truncated gag mutants to produce HIV-like particles, Sf9 cells were infected 20% 2 (c) 3 4 : 5 ~ 6 ~ 7 8 9 60% :S::.: ::::: Fig. 3. Sucrose gradient analysis of gag particles. Supernatants from cultures infected at high multiplicity were harvested 2 days postinfection and layered onto preformed gradients of 20% to 60% sucrose in PBS. The gradients were centrifuged at 36000 r.p.m, for 100 rain and fractionated from the top. Aliquots of each fraction were electrophoresed on 10% SDS polyacrylamide gels and Western blotted with antiPr24 MAb. p46, p45, p44 and P42, (a) to (d) respectively. with virus at high multiplicity and the supernatants were harvested 2 days post-infection before appreciable cell lysis had occurred. After clarification, supernatants were applied to a sucrose density gradient as described (Gheysen et al., 1989) and the gradient was fractionated and analysed by Western blotting using anti-gag MAbs (Fig. 3). We found that truncation mutants Pr46 (a), Pr45 Downloaded from www.microbiologyresearch.org by IP: 88.99.165.207 On: Fri, 16 Jun 2017 23:40:03 3082 J. B. M. Jowett and others Fig. 4. Electron micrographsof truncated gag mutant-infectedSf9 cells. Cells were processed as described 2 days after infection with Pr46 (a), Pr45 (b), Pr44 (c) or Pr42 (d). Surfacevacuoleformation was observedonlywith Pr42 and is marked V. Free Pr42 particles are shown (FP). The bar marker represents 100 nm. (b) and Pr44 (c) all produced gag-containing particles that migrated to a position similar to Pr55 (45 ~ sucrose). Truncation mutant Pr42 (d) also produced core-like particles, but they sedimented in 25 to 3 0 ~ sucrose as compared to 45~o sucrose for wild-type. Electron microscopy Deletion of gag C-terminal sequences was clearly not incompatible with expression and secretion of gag protein that could be banded by velocity gradient centrifugation (Fig. 3). However, the exact macromolecular state of this protein could not be deduced by gradient analysis alone. Accordingly, we examined the culture supernatant by negative staining and also prepared thin sections through infected Sf9 cells for direct visualization of the particle budding process. Typical virus-like particles were found in all samples (Fig. 4). Particle morphology and budding for Pr55 was similar to that described earlier and that Pr46 (a), Pr45 (b) and Pr44 (c) was similar. Generally particle formation occurred at the plasma membrane, producing roughly spherical particles about 120 nm in diameter. There was some evidence of intracytoplasmic gag 'ring' structures typical of the structures formed in the absence of gag myristylation (Gheysen et Downloaded from www.microbiologyresearch.org by IP: 88.99.165.207 On: Fri, 16 Jun 2017 23:40:03 HIV-1 Pr55 RNA-binding signals al., 1989; Overton et al., 1989; Gelderblom, 1991), but the number of these structures was small. However, Pr42 in addition to normal budding at the cell surface, showed some budding into intracellular and cell surface vacuoles (marked V in Fig. 4d) as well as from the plasma membrane. Particles formed within vacuoles had essentially normal morphology but showed a greater range of size than the surface particles (average approx. 130 nm). The increase in particle diameter associated with Pr42 may partly explain the altered banding properties of this mutant in velocity gradients (Fig. 3d). We conclude from the data presented in Fig. 3 and 4 that, within the baculovirus expression system, deletion of the gag Pr6 domain and a large proportion of the Pr7 domain including the two Cys-His boxes does not prevent gag particle assembly or release. A link with RNA binding? Although particle assembly was clearly independent of the presence of the Cys-His domain of gag, a link with RNA binding could not be ruled out. For example, in some retroviruses specific RNA binding has been shown to be associated with the matrix domain of the gag protein (Katoh & Yoshinaka, 1990), which is present in all our deletion mutants. Therefore we examined the ability of each of our truncated gag proteins to capture RNA representative of the HIV genome. The exact extent of the cis-acting sequences (the psi site) necessary for the efficient incorporation of genomic RNA into HIV particles is not yet clear. The region of the molecule from the 3' end of the 5' long terminal repeat to the beginning of the gag ORF is clearly necessary, but has not yet been shown to be sufficient for efficient packaging (Lever et al., 1989; Clavel & Orenstein, 1990). To assess the truncated gag proteins for RNA binding we used North-Western blotting with a probe encompassing the supposed psi site and some of the 5' end of gag. This system has been shown recently to give specific RNA binding to Pr55 (Luban & Goff, 1991). The protein profile observed on the blot was similar to that shown in Fig. 2(a). We found efficient RNA binding associated with Pr55 and with each of the Pr55 breakdown products (Fig. 5, lane 1) suggested earlier to lack C-terminal sequences (Fig. 2 and discussion thereof). Consistent with this we also observed RNA binding with Pr46 and Pr45 (Fig. 5, lanes 2 and 3). However, we observed substantially reduced RNA binding associated with Pr44 (one CysHis box; lane 4) and none with Pr42 (no Cys-His boxes; lane 5). Background binding to a set of cellular proteins can be discerned in wild-type baculovirus- and mockinfected cells (lanes 6 and 7), but was poor compared to gag-related activity and did not obscure any of the 2 1 3 4 5 6 3083 7 Fig. 5. Specific RNA binding by each gag construct. Infections were processed and transferred as described in the legend to Fig. 2 except that lanes were loaded with samples normalized for the amount of gag antigen present before the transfer. North-Western blotting was done as described in Methods. Lane 1, Pr55; 2, Pr46; 3, Pr45; 4, Pr44; 5, Pr42; 6, wild-type baculovirus-infected cells; 7, mock-infected cells. L p17 ] p24 I p7 ] p6 ] ARVLAEAMSQVTNTATIMMQRGNFRNQRKMVKCFN ! l ! ! Gag p41 Gag p41.5 AcNPVgagl4myr + vAcGagCfr 1 Gag p42 Fig. 6. Fine endpoint mapping of sequences involved in gag particle assembly. The amino acid sequence of the gag Pr24-Pr7 junction is shown with each of the two potential HIV protease cleavage sites shown as large arrow heads. The position of the two gag deletions reported previously (vAcGagCfrl and AcNPVgagl4myr) is shown in addition to that of the constructs described here. In each truncation the codon for the amino acid indicated is replaced by a stop codon. truncated gag bands. One breakdown product of Pr55 with an Mr of approximately 20K also bound probe but was absent from the gag truncation mutants, suggesting it may represent a Prl5-containing fragment. NorthWestern blotting with a non-specific RNA probe gave only background binding (data not shown). This result confirms that Cys-His boxes are essential for RNA capture, although it does not rule out the involvement of other gag sequences. It is also clear that particle formation, demonstrated for each truncation mutant, is not linked to the ability to bind RNA, as represented by the probe used for our blotting experiments. Although we cannot wholly rule out co-incorporation of non-specific RNA fragments into the developing particle, the fact Downloaded from www.microbiologyresearch.org by IP: 88.99.165.207 On: Fri, 16 Jun 2017 23:40:03 3084 J. B. M. Jowett and others Fig. 7. Electronmicrographsof Sf9 cellsinfectedwith Pr41.5 (a) and Pr41 (b). The micrographsshownare typicalof manysections examined.Grosscellsurfacedistortionis apparentin bothinfections,but no particlesare apparentin either.The bar markerrepresents 200 nm. that non-specific probes do not bind to gag protein suggests that this is unlikely. Endpoint mapping of sequences involved in particle formation Previous work using baculovirus (Gheysen et al., 1989) and vaccinia virus expression systems (Hoshikawa et al., 1991) has suggested that truncation of the HIV gagcoding sequence at the distal end of the Pr24 domain abolishes particle formation. However, one recent report has claimed that deletions in this area still allow particles to be formed, although the evidence presented in favour of this was scant (Royer et al., 1991). The HIV protease can cleave at two distinct sites at the end of the Pr24 domain, VLAE (amino acids 362 to 365) and IMMQ (amino acids 376 to 379) (see Fig. 6). This can lead to some confusion over the exact C terminus of Pr24. We found that one of the two reports detailing particle abolition had truncated the gag coding sequence from the upstream site whereas the report detailing continued particle formation had deleted sequences C-terminal to the alternative downstream site. Thus, the 3' limit of gag sequences necessary for particle formation might lie between these two sites, both of which are upstream of the gag construct, Pr42 (Fig. 1), with the largest deletion which still forms particles. To confirm the boundary for particle formation, we constructed two more gag truncation mutants (Pr41 and Pr41.5; Fig. 6). The first is deleted from the upper of the two Pr24 C-terminal protease cleavage sites (amino acid 363) and the second from amino acid 372, located between the two possible cleavage sites. The level of expression of each mutant was similar to that of the constructs already described, but no antigen was found in the tissue culture superna- tant (data not shown). When analysed by electron microscopy, neither mutant showed evidence of particle formation (Fig. 7). Electron-dense material typical of gag protein was found just beneath the plasma membrane of infected cells. The cells had abundant large surface vacuoles, with the dense protein layer found between the vacuole and the cell surface membranes, and these electron-dense layers labelled specifically with an antigag MAb and gold conjugate (not shown). Similar structures have been observed in earlier studies (Gheysen et al., 1989). Based on these results and those of Royer et al. (1991), we deduce that the C-terminal boundary for the sequences involved in HIV gag particle formation lies between amino acids 372 and 379, and spans the known downstream protease cleavage site at the end of the Pr24 domain. Discussion The ability of gag gene products to self-assemble following expression has been established for a number of retroviruses, bovine (Rasmussen et al., 1990), feline (Morikawa et al., 1991), human (Gheysen et al., 1989; Karacostas et al., 1989; Overton et al., 1989; Hu et al., 1990; Luo et al., 1990; Shioda & Shibuta, 1990; Smith et al., 1990; Haffar et al., 1991; Hoshikawa et al., 1991; Royer et al., 1991; Mergener et al., 1992) and simian immunodeficiency viruses (Delchambre et al., 1989). However, the boundaries of the gag sequences necessary for particle formation have not been systematically determined. Gag-pol fusion proteins expressed in similar systems have failed to yield particles and, as the frameshift event producing the gag-pol fusion protein also removes the Pr6 domain of gag, a role for the Pr6 Downloaded from www.microbiologyresearch.org by IP: 88.99.165.207 On: Fri, 16 Jun 2017 23:40:03 H I V - 1 Pr55 R N A - b i n d i n g signals domain in particle formation was feasible. However, we have shown that deletion of Pr6 leads to the production of gag particles that are indistinguishable from those produced by Pr55. Therefore the failure of gag-pol fusion proteins to assemble is most likely due to steric effects imposed by the presence of the large pol domain. These results suggest that incorporation of the HIV gagpol precursor into forming virions is gag-driven as shown for other retrovirus systems (Felsenstein & Goff, 1988). Gottlinger et al. (1991) have shown that deletion of the Pr6 domain within HIV proviral clones results in HIV particle formation but suppression of particle release from transfected COS-7 cells. They suggested that lack of Pr6 might prevent the final stages of particle assembly which, in turn, leads to prevention of particle release. From our own findings and those recently published (Hoshikawa et al., 1991 ; Royer et al., 1991) we suggest that particle assembly and release are separable events. Lack of Pr6 evidently does not affect particle assembly per se, but does appear to prevent particle release when all other HIV-encoded proteins are present. During the expression of gag products only, and irrespective of the expression system used (recombinant baculoviruses, this work and Royer et al., 1991; recombinant vaccinia viruses, Hoshikawa et al., 1991), gag proteins lacking the Pr6 domain are efficiently released from infected cells. This finding argues that as yet undefined HIV-encoded products may be actively involved in HIV budding from permissive cells once formation of the membraneassociated protein shell is complete, as suggested for other retroviruses (Luftig et al., 1990). Alternatively, vaccinia virus or baculoviruses could provide the functions necessary for gag particle release in the absence of the Pr6 domain. We also investigated the role of the Pr7 domain in gag particle assembly. Pr7 is undoubtedly the nucleocapsid protein of HIV as mutations in the Cys-His arrays within this domain severely depress the incorporation of genomic R N A into forming virions (Gorelick et al., 1990). Gheysen et al. (1989) originally showed that complete deletion of Pr7 leads to loss of particle assembly, a result recently confirmed by Hoshikawa et al. (199t). Thus, in addition to the RNA-binding activity, the C-terminal boundary of the region enabling gag particle formation is also within the Pr7 domain. To determine the endpoint of such sequences and to investigate a possible link with R N A binding, we produced a series of truncations through Pr7 up to and including the endpoint originally described by Gheysen et al. (1989). Deletion of both Cys-His motifs in these constructs led to a complete loss of specific R N A binding, with loss of the downstream motif (construct Pr44) causing a 7 0 ~ reduction in binding. These results are consistent with mutation studies that disrupt one or 3085 other of the Cys-His motifs (Gorelick et al., 1990; Luban & Goff, 1991). Particle formation was apparent despite removal of one (Pr44) or two (Pr42) Cys-His arrays, indicating that the signals necessary for particle formation do not include either motif. However it is worth noting that Pr42 demonstrated some cell surface vacuolation in addition to typical particle formation, suggesting that a proportion of the expressed gag protein in this construct fails to assemble successfully into particles. Pr42 particles are marginally larger (about 10~) on average than the particles produced by constructs that retain RNA-binding capability. Therefore it is possible that RNA incorporation acts as a condensing agent helping the gag core to adopt a tighter conformation. Absence of R N A might also contribute to the altered sedimentation of Pr42 particles in sucrose gradients. As Pr42 retains particle formation, the downstream sequence essential for particle assembly lies N-terminal to amino acid 390. Royer et al. (1991) have recently proposed that deletion of gag sequences downstream of amino acid 379 (their mutant AcNPVgagl4myr) does not affect particle morphogenesis. However the electron micrograph of cells infected with this truncation mutant shows no free particles when compared to those of the other gag truncations described, but does show evidence of plasma membrane vacuolation, similar to our Pr42 mutant. These data suggest that both mutants encroach upon the signals necessary for particle formation, although they do not delete them entirely. Two further truncations (Pr41 and Pr41.5) N-terminal to Pr42 and AcNPVgagl4myr fail to show any evidence of particle assembly, producing only cell surface vacuoles with associated layers of protein. This result confirms and extends the observations of Gheysen et al. (1989) to locate the downstream boundary for particle formation to between amino acids 372 (our mutant Pr41.5) and 379 (AcNPVgagl4myr; Royer et al., 1991). The identification of this region as overlapping the downstream cleavage site for the HIV protease at the Pr24/Pr7 junction is fitting as activation of the protease at this site during HIV budding but prior to release would result in the abolition of particle formation. Further deletion analysis of Pr55 should allow the definition of the minimum sequences required for particle assembly, as has been reported for other retroviruses (reviewed in Wills & Craven, 1991). Gag-only particles of the type described have a number of uses as 'particle carriers', for example of the HIV env protein, to produce non-replicating vaccine candidates (Haffar et al., 1991). We suggest that if this technology comes into widespread use for the production of recombinant vaccines, the use of constructs similar to Pr42 be encouraged as they would prevent the possible transduction of R N A to recipient ceils. Downloaded from www.microbiologyresearch.org by IP: 88.99.165.207 On: Fri, 16 Jun 2017 23:40:03 3086 J. B. M . Jowett and others I.M.J. thanks Y.M. for many things. This work was supported by the UK Medical Research Council's AIDS Directed Programme. References CLAVEL, F. & ORENSTEIN, J. M. (1990). A mutant of human immunodeficiency virus with reduced RNA packaging and abnormal particle morphology. Journal of Virology 64, 5230-5234. DELCHAMBRE, M., GHEYSEN, D., THINES, n., THIRIART, C., JACOBS,E., VERDIN, E., HORTH, M., BURNY, A. & BEX, F. (1989). The Gag precursor of simian immunodeficiency virus assembles into viruslike particles. EMBO Journal 8, 2653-2660. FELSENSTEIN, K. M. & GOFF, S. P. (1988). Expression of the Gag-Pol fusion protein of Moloney murine leukemia virus without Gag protein does not induce virion formation or proteolytic processing. Journal of Virology 62, 2179-2182. GELDERBLOM, H. R. (1991). Assembly and morphology of HIV: potential effect of structure on viral function (editorial). AIDS 5, 617~537. GHEYSEN, n., JACOBS,E., DE-FORESTA, F., THIRIART, C., FRANCOTTE, M., THINES, D. & DE-WILDE, M. (1989). Assembly and release of HIV-1 precursor Pr55gag virus-like particles from recombinant baculovirus-infected insect cells. Cell 59, 103-112. GORELICK, R. J., NIGIDA, S. M., JR, BESS, J. W., JR, ARTHUR, L. O., HENDERSON, L. E. & REIN, A. (1990). Noninfectious human immunodeficiency virus type 1 mutants deficient in genomic RNA. Journal of Virology 64, 3207-3211. GOTTLINGER, H. G., DORFMAN, T., SODROSKI, J. G. & HASELTINE, W. A. (1991). Effect of mutations affecting the Pr6 Gag protein on human immunodeficiency virus particle release. Proceedings of the National Academy of Sciences, U.S.A. 88, 3195-3199. HAFFAR, O. K., SMITHGALL, M. D., MORAN, P. A., TRAVlS, B. M., ZARLING, J. M. ~£ HU, S. L. (1991). HIV-specific humoral and cellular immunity in rabbits vaccinated with recombinant human immunodeficiency virus Gag-Env particles. Virology 183, 487-495. HOSHIKAWA, N., KOJIMA, A., YASUDA, A., TAKAYASHIKI,E., MUSAKO, S., CHIBA, J., SATA,T. & KURATA, T. (1991). Role of the gag andpol genes of human immunodeficiency virus in the morphogenesis and maturation of retrovirus-like particles expressed by recombinant vaccinia virus: an ultrastructural study. Journal of General Virology 72, 2509-2517. Hu, S. L., TRAVIS, B. M., GARRIGUES,J., ZARLING, J. M., SRIDHAR, P., DYKERS, T., EICHBERG, J. W. & ALPERS, C. (1990). Processing, assembly, and immunogenicity of human immunodeficiency virus core antigens expressed by recombinant vaccinia virus. Virology 179, 321-329. JACKS, T., POWER, M. D., MASlARZ,F. R., LucIw, P. A., BARR, P. J. & VARMUS, H. E. (1988). Characterization of ribosomal frameshifting in HIV-I Gag-Pol expression. Nature, London 331, 280-283. KARACOSTAS, V., NAGASHIMA,K., GONDA, M. A. & MOSS, B. (1989). Human immunodeficiency virus-like particles produced by a vaccinia virus expression vector. Proceedings of the National Academy of Sciences, U.S.A. 86, 8964-8967. KATOH, I. & YOSHINAKA, Y. (1990). RNA-binding activities of bovine leukemia virus gag proteins. Abstracts of the VIIIth International Conference of Virology. Berlin, 26 to 31 August, 1990. Abstract W45-005, p. 80. KIENY, M. P. (1990). Structure and regulation of the human AIDS virus. Journalof Acquired Immune Deficiency Syndromes 3, 395-402. KITTS, P., AYRES, M. & POSSEE, R. (1991). Linearisation of baculovirus DNA improves the selection of recombinants. Nucleic Acids Research lg, 5667-5672. KUNKEL, T. A. (1985). Rapid and efficient site-specific mutagenesis without phenotypic selection. Proceedingsof the National Academy of Sciences, U.S.A. 82, 488-492. LEVER, A., GOTTLINGER, H., HASELTINE, W. & SODROSKI, S. (1989). Identification of a sequence required for efficient packaging of human immunodeficiency virus type 1 RNA into virions. Journalof Virology 63, 4085-4087. LIVINGSTONE, C. & JONES, I. M. (1989). Baculovirus expression vectors with single-strand capability. Nucleic Acids Research 17, 2366. LOEBER, G., STENGER, J. E., RAY, S., PARSONS,R. E., ANDERSON, M. E. & TEGTMEYER, P. (1991). The zinc finger region of simian virus 40 large T antigen is needed for hexamer assembly and origin melting. Journal of Virology 65, 3167-3174. LUBAN, J. & GOFF, S. P. (1991). Binding of human immunodeficiency virus type 1 (HIV-1) RNA to recombinant HIV-I Gag polyprotein. Journal of Virology 65, 3203-3212. LUFTIG, R., IKUTA, K., BU, i . & CALKINS, P. (1990). Terminal stages of retroviral morphogenesis. In Retroviral Proteases : Maturation and Morphogenesis, pp. 141-148. Edited by L. H. Pearl. London: Macmillan. Luo, L., LI, Y. & KANG, Y. (1990). Expression of Gag precursor protein and secretion of virus-like particles of HIV-2 from recombinant baculovirus infected insect cells. Virology 179, 874-880. MERGENER, K., FACKE, M., WELKER, R., BRINKMAN, V., GELDERBLOM, H. R. & KRAUSSLICH, H. G. (1992). Analysis of HIV particle formation using transient expression of subviral constructs in mammalian cells. Virology 186, 25 39. MERVIS, R. J., AHMAD, N., LILLEHOJ,E. P., RAUM,M. G., SALAZAR, F. H., CHAN, H. W. & VENKATESAN,S. (1988). The gag gene products of human immunodeficiency virus type 1 : alignment within the gag open reading frame, identification of post-translational modifications, and evidence for alternative Gag precursors. Journal of Virology 62, 3993-4002. MORIKAWA, S., BOOTH, T. F. & BISHOP, D. H. (1991). Analyses of the requirements for the synthesis of virus-like particles by feline immunodeficiency virus Gag using baculovirus vectors. Virology 183, 288-297. OVERTON, H. A., FUJII, Y., PRICE, I. g. & JONES, I. M. (1989). The protease and gag gene products of the human immunodeficiency virus: authentic cleavage and post-translational modification in an insect cell expression system. Virology 170, 107-116. RASMUSSEN, L., BATTLES, J. K., ENNIS, W. H., NAGASHIMA, K. & GONDA, M. A. (1990). Characterization of virus-like particles produced by a recombinant baculovirus containing the gag gene of the bovine immunodeficiency-like virus. Virology 178, 435-451. ROYER, i . , CERUTTI, M., GAY, B., HONG, S. S., DEVAUCHELLE,G. & BOULANGER, P. (1991). Functional domains of HIV-1 Gag-polyprotein expressed in baculovirus-infected insect cells. Virology 184, 417-422. SAMBROOK, J., FRITSCH, E. F. & MANIATIS, T. (1989). Molecular Cloning: A Laboratory Manual, 2nd edn. New York: Cold Spring Harbor Laboratory. SHIODA, T. & SHmUTA, H. (1990). Production of human immunodeficiency virus (HIV)-like particles from cells infected with recombinant vaccinia viruses carrying the gag gene of HIV. Virology 175, 139-148. SMITH, A. J., CHO, M. I., HAMMARSKJOLD,M. L. & REKOSH, D. (1990). Human immunodeficiency virus type 1 Pr55gag and Prl60Gag-Pol expressed from a simian virus 40 late replacement vector are efficiently processed and assembled into virus like particles. Journal of Virology 64, 2743-2750. SUMMERS, M. D. & SMITH, G. E. (1987). A Manual of Methods for Baculovirus Vectors and Insect Cell Culture Procedures. Texas Agricultural Experimental Research Station. Bulletin no. 1555. VERONESE, F. D., RAHMAN, R., COPELAND, T. D., OROSZLAN, S., GALLO, R. C. • SARNGADHARAN,M. G. (1987). Immunological and chemical analysis of Pr6, the carboxy terminal fragment of HIV Prl5. AIDS Research and Human Retroviruses 3, 253-264. VERONESE, F. D., COPELAND, T. n., OROSZLAN, S., GALLO, R. C. & SARNGADHARAN, M. G. (1988). Biochemical and immunological analysis of human immunodeficiency virus gag gene products Prl7 and Pr24. Journal of Virology 62, 795-801. WILLS, J. W. & CRAVEN, R. C. (1991). Form, function, and use of retroviral Gag proteins (editorial). AIDS 5, 639-654. (Received 24 June 1992; Accepted 4 August 1992) Downloaded from www.microbiologyresearch.org by IP: 88.99.165.207 On: Fri, 16 Jun 2017 23:40:03