• Study Resource
  • Explore Categories
    • Arts & Humanities
    • Business
    • Engineering & Technology
    • Foreign Language
    • History
    • Math
    • Science
    • Social Science

    Top subcategories

    • Advanced Math
    • Algebra
    • Basic Math
    • Calculus
    • Geometry
    • Linear Algebra
    • Pre-Algebra
    • Pre-Calculus
    • Statistics And Probability
    • Trigonometry
    • other →

    Top subcategories

    • Astronomy
    • Astrophysics
    • Biology
    • Chemistry
    • Earth Science
    • Environmental Science
    • Health Science
    • Physics
    • other →

    Top subcategories

    • Anthropology
    • Law
    • Political Science
    • Psychology
    • Sociology
    • other →

    Top subcategories

    • Accounting
    • Economics
    • Finance
    • Management
    • other →

    Top subcategories

    • Aerospace Engineering
    • Bioengineering
    • Chemical Engineering
    • Civil Engineering
    • Computer Science
    • Electrical Engineering
    • Industrial Engineering
    • Mechanical Engineering
    • Web Design
    • other →

    Top subcategories

    • Architecture
    • Communications
    • English
    • Gender Studies
    • Music
    • Performing Arts
    • Philosophy
    • Religious Studies
    • Writing
    • other →

    Top subcategories

    • Ancient History
    • European History
    • US History
    • World History
    • other →

    Top subcategories

    • Croatian
    • Czech
    • Finnish
    • Greek
    • Hindi
    • Japanese
    • Korean
    • Persian
    • Swedish
    • Turkish
    • other →
 
Profile Documents Logout
Upload
Chapter18_Section03_JKedit
Chapter18_Section03_JKedit

... The three domains are: • Eukarya, which is composed of protists, fungi, plants, and animals. • Bacteria, which corresponds to the kingdom Eubacteria. • Archaea, which corresponds to the kingdom Archaebacteria. ...
Crystal Structures of Two Viral IRES RNA Domains Bound to the
Crystal Structures of Two Viral IRES RNA Domains Bound to the

... complexity of IRES initiation, the Dicistroviradae intergenic region (IGR) IRES was chosen which uses the most streamlined mechanism known, directly binding to the ribosome without the need for an initiator tRNA or any initiation factors. Earlier structural and biochemical studies revealed a ribosom ...


... expressing particular genes only when required. Gene expression in bacteria is regulated primarily at the level of transcription initiation by modulating promoter recognition of the RNA polymerase (RNAP) holoenzyme. The bacterial RNAP holoenzyme is composed of a five-subunit core enzyme (RNAPc; subu ...
Kingdom Archaea 2009
Kingdom Archaea 2009

... smokers (right). ...
Key Terms
Key Terms

... metabolism. Because cellular respiration consists of a series of reactions, it is referred to as a metabolic pathway. A specific enzyme catalyzes (speeds up) each reaction in a metabolic pathway. Figure 7-16 is a simplified "road map" of cellular respiration. You can use the diagram to follow glucos ...
07_Lecture_Presentation
07_Lecture_Presentation

... • As temperatures cool, membranes switch from a fluid state to a solid state • The temperature at which a membrane solidifies depends on the types of lipids • Membranes rich in unsaturated fatty acids are more fluid than those rich in saturated fatty acids • Membranes must be fluid to work properly ...
3.6 Enzymes - hrsbstaff.ednet.ns.ca
3.6 Enzymes - hrsbstaff.ednet.ns.ca

...  Enzymes are globular ...
Structure-activity Relationships in Flexible Protein Domains
Structure-activity Relationships in Flexible Protein Domains

... are not necessarily valid. Various modi®cations of the model-free analysis have been used in attempts ...
No Slide Title
No Slide Title

... • Only demonstrated for a single protein, SkpI, in Dictyostelium • SkpI involved in ubiquitination of cell cycle proteins • Attached O-linked chain at Pro-143 (not conserved) which is first hydroxylated to HyPro ...
Lanosterol Biosynthesis in the Membrane Environment
Lanosterol Biosynthesis in the Membrane Environment

... hydrophobic channels? What unique features arise when protein conformational changes are linked to the membrane bulk environment? Does the unique interface with the lipid bilayer assist in substrate channeling in biosynthetic pathways? These fundamental questions regarding the behavior of monotopic ...
ap biology 2007 scoring guidelines - AP Central
ap biology 2007 scoring guidelines - AP Central

... The intent of this question was to assess students’ understanding of membrane structure and function. The two-part question asked them to describe the structure and function of macromolecular components of the plasma membrane and to discuss the role of membranes in several cellular and biological pr ...
sv-lncs - Department of Computer Science and Engineering
sv-lncs - Department of Computer Science and Engineering

... Before going in detail about MSC by probability lets take care of the input and the data structures used to implement MSC. In order to use MSC you need to have a training data set. This data set needs to include several protein interactions and the protein structure of every protein involved in an i ...
Localization of protein-binding sites within families of proteins
Localization of protein-binding sites within families of proteins

... domain family in the Structural Classification of Proteins (SCOP), protein-binding sites are extracted from our comprehensive database of structurally defined binary domain interactions (PIBASE). Second, the binding sites within each family are superposed using a structural alignment of its members. ...
1+1+1 - Computer Science, Columbia University
1+1+1 - Computer Science, Columbia University

... TAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSAS TGLYKETNTILSWSFTSKLKSNSTHETNALHFMFNQFSKDQKDLILQG DATTGTDGNLELTRVSSNGPQGSSVGRALFYAPVHIWESSAVVASFEA TFTFLIKSPDSHPADGIAFFISNIDSSIPSGSTGRLLGLFPDAN ...
Lecture 06 Absorption 1
Lecture 06 Absorption 1

... Vesicles are internal membrane compartments that move between the cytosol and membranes. This movement is regulated by external factors Vesicles contain the transport proteins that absorb the mineral into the lumen of the vesicle and bring it into the cell Vesicles that have fused with the membrane ...
Chapter 1 The Framework of Biology
Chapter 1 The Framework of Biology

... Being small solves many problems. Gas diffusion and water balance are more easily performed because of prokaryotes' small size. ...
Enzymes
Enzymes

... reaction without itself being destroyed or changed in any way.  K m: (Michaelis constant) The substrate concentration at which an enzyme catalysed reaction proceeds at half the maximum velocity.  V max: (Maximum velocity) The maximum initial velocity of an enzyme catalysed reaction; determined by ...
Structure of Mammalian AMPK and its regulation by ADP
Structure of Mammalian AMPK and its regulation by ADP

... dephosphorylation of Thr172 and we recently provided evidence that protection against dephosphorylation is the major physiological mechanism for activation of AMPK  In addition to activation by phosphorylation, AMP causes a 2–5-fold allosteric activation of AMPK depending on the nature of the isofo ...
The orphan histidine protein kinase SgmT is a cdiGMP receptor and
The orphan histidine protein kinase SgmT is a cdiGMP receptor and

... A fundamental property of bacterial cells is their ability to respond to changes in the extracellular and intracellular environments. In this context, specific inputs are coupled to specific outputs by dynamically interacting signalling proteins organized in regulatory pathways. In order to ensure a ...
Yamada et al., Cell 2005
Yamada et al., Cell 2005

... identified with diverse protein structures but with same extracellular cadherin repeats ...
Stitching proteins into membranes, not sew simple
Stitching proteins into membranes, not sew simple

... SS flipping that could be influenced by nascent polypeptide length, charge difference and signal sequence hydrophobicity (Goder and Spiess, 2003). Reorientation of the first TM domain in this way may be a more widespread phenomenon than one might intuitively expect as it has also been observed to oc ...
Glycolysis
Glycolysis

... Glycolysis  Breaking down glucose ...
Yeast as a Model Organism to Study Transport and
Yeast as a Model Organism to Study Transport and

... transition of cells with conditional sit4 hal3 mutations (Simón et al. 2001). This function was independent of the role of the antiporter in improving tolerance to sodium cations, and it required the integrity of a relatively large region (amino acids 800-948) of its C-terminus. A screening for loss ...
Two-step and one-step secretion mechanisms in Gram
Two-step and one-step secretion mechanisms in Gram

... (Fim A, F, G and H), whereas the P pili cluster codes for six known subunits (Pap A, H, K, E, F and G). In both systems, these subunits are arranged into two sub-assemblies: the pilus ‘rod’ and the ‘tip fibrillum’ (Figure 1). The rod is a long thick rigid structure with a ∼ 6.8 nm diameter made up o ...
File
File

...  Unicellular organisms are made from one cell  The two main types are called: prokaryote and eukaryote  Prokaryotes do not have nucleus or organelles, and come in different sizes and shapes. Bacteria is an example of a ...
< 1 ... 16 17 18 19 20 21 22 23 24 ... 53 >

P-type ATPase



The P-type ATPases, also known as E1-E2 ATPases, are a large group of evolutionarily related ion and lipid pumps that are found in bacteria, archaea, and eukaryotes. They are α-helical bundle primary transporters referred to as P-type ATPases because they catalyze auto- (or self-) phosphorylation of a key conserved aspartate residue within the pump. In addition, they all appear to interconvert between at least two different conformations, denoted by E1 and E2.Most members of this transporter family are specific for the pumping of a large array of cations, however one subfamily is involved in flipping phospholipids to maintain the asymmetric nature of the biomembrane.Prominent examples of P-type ATPases are the sodium-potassium pump (Na+,K+-ATPase), the plasma membrane proton pump (H+-ATPase), the proton-potassium pump (H+,K+-ATPase), and the calcium pump (Ca2+-ATPase).
  • studyres.com © 2025
  • DMCA
  • Privacy
  • Terms
  • Report