* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Download TITLE : BLAST
Protein (nutrient) wikipedia , lookup
Protein adsorption wikipedia , lookup
Community fingerprinting wikipedia , lookup
Genetic code wikipedia , lookup
Molecular evolution wikipedia , lookup
Protein structure prediction wikipedia , lookup
Point mutation wikipedia , lookup
Two-hybrid screening wikipedia , lookup
Artificial gene synthesis wikipedia , lookup
Ancestral sequence reconstruction wikipedia , lookup
TITLE : BLAST 1 2 Table of Contents 1.0 Introduction to Blast ------------------------------------------------------------------------------ 4 2.0 Types of Blast --------------------------------------------------------------------------------------11 3.0 Common Databases for Use with BLAST available at NCBI ----------------------------21 4.0 How Blast Work? -------------------------------------------------------------------------------- 29 5.0 Interpretation of Blast Result ------------------------------------------------------------------38 3 Basic Local Alignment Search Tool (BLAST) 1.0 Introduction Basic Local Alignment Search Tool (BLAST) is an algorithm used for comparing primary biological sequence information such as nucleotides sequence and amino-acids sequence in order to find regions of local similarity. BLAST algorithm having the same function with FASTA algorithm . However, BLAST works faster and more time-efficient than FASTA. FASTA will compared it’s query sequence though out all database sequences while BLAST will search for the high number of similar local regions and gives the result after a threshold value reached. BLAST also widely used among bioinformatics researchers due to its availability on the World Wide Web through a large server at the NCBI (National Center for Biotechnology Information). Some other site that may use BLAST as well are GenomeNet, ExPasy and FlyBase. There still other sites uses BLAST. 4 1.1 Background Designed by Eugene Myers at the University of Arizona, Stephen Altschul, Warren Gish, and David J.Lipman at the U.S. National Center for Biotechnology Information (NCBI) and Webb Miller at the Pennsylvania State University. It was published in the Journal of Molecular Biology in 1990. The earlier version of BLAST algorithm is Smith-Waterman algorithm. BLAST is faster than Smith-Waterman algorithm. 1.2 Uses of BLAST There are some uses of BLAST underlined by Wikipedia website. 1.2.1 Identifying species BLAST can identify a species and find homologous species correctly. This is very useful when we are working with a DNA sequence from an unknown species. 1.2.2 Locating domains BLAST can locate known domain within the sequence of interest when we are working with a protein sequence. 1.2.3 DNA mapping When working with a known species, and looking to sequence a gene at an unknown location, BLAST can compare the chromosomal position of the sequence of interest, to relevant sequences in the database(s). 1.2.4 Comparison When working with genes, BLAST can locate common genes in two related species, and can be used to map annotations from one organism to another. 5 1.3 Input Input sequences are either in FASTA or Genbank format. 1.3.1 FASTA FASTA is also known as Pearson format Advantages: Easy to manipulate and parse sequences using text-processing processing tools and scripting languages like Python, Ruby, and Perl. FASTA format is a text-based based format for representing either nucleotide sequences or peptide sequences, in which nucleotides or amino acids are represented using single single-letter codes. Nucleic acids code supported (Nucleotide Sequence): Amino acids code supported (Peptide Sequence): 6 *Noted that the degenerate nucleotide codes in red are treated as mismatches in nucleotide alignment. Restrictions of FASTA format input: all lines of text be shorter than 80 characters in length. The description line is distinguished from the sequence data by a greater greater-than (">") symbol at the beginning. Blank lines are not allowed in the middle of FASTA input. lower-case case letters are accepted and are mapped into upper-case a single hyphen or dash (‘ - ’) can be used to represent a gap of indeterminate length. In amino acid sequences, sequences, U and * are acceptable letters (see above). U is replaced by X first before the search since it is not specified specified in any scoring matrices. Before submitting a request, any numerical digits in the query sequence should either be removed or replaced by appropriate letter codes (e.g., N for unknown nucleic acid residue or X for unknown amino acid residue). Too many degenerate enerate codes within an input nucleotide query will cause blast.cgi to reject the input. To represent gaps, use a string of N or X instead of ‘ - ’. 7 Example of input in FASTA format: Example of barely sequence input : Example of Multi Sequence FASTA FAS file: 8 1.3.2 Genebank Genbank sequence database is an open access. It is an annotated collection of all publicly available nucleotide sequences and their protein translation. Contained over 65 billion nucleotide bases in more than 61 million sequences in its database. Identifier such as accession, accession.version or gi's usually used as an input . Example of acceptable Genebank input : CAA89576 CAA89576.1 1015707 gi|1015707 9 1.4 Output BLAST output can be delivered in a variety of formats include HTML, plain text, and XML formatting. For NCBI's web-page, the default format for output is HTML. Result on NCBI are given in a graphical format showing the hits found, a table showing sequence identifiers for the hits with scoring related data, as well as alignments for the sequence of interest and the hits received with corresponding BLAST scores for these. The easiest to read and most informative of these is probably the table. 10 2.0 Types of BLAST Basic Local Alignment Search Tool (BLAST) is one of bioinformatics tool that hosted by National Center for Bioinformatics Information (NCBI) that allows similarity searches against the databases of proteins or DNA which has been constantly updated. In BLAST, there are different program and tools that help anyone that are doing research or study in this area. There are five types of BLAST tools. 1. Nucleotide BLAST In nucleotide BLAST tools, user must be using the nucleotide query as the sequence, and then NCBI will search the inserted query against the nucleotide database. -blastn In blastn algorithm, nucleotide query will be compared against the nucleotide database. 11 Figure 2.1: Nucleotide BLAST interface - Megablast Megablast is one types of nucleotide BLAST algorithm. This algorithm specifies to identify an unknown query/sequence that has been inserted by user whether the query/sequence already exists in other public database. Furthermore, megablast used to compare two large sets of sequences swiftly. Besides that, this algorithm will efficiently search long alignments between similar query/sequence. In correspond to use this algorithm, users must choose in program selection. Megablast algorithm is specifically designed to efficiently find long alignments between very similar sequences and thus is the best tool to use to find the identical match to your query sequence. Figure 2.2 Megablast algorithm interface Example of nucleotide query: acatgggattatcaatcaccagttaacaacaatcttcagtcttccaccataactcagtgtaaaaccgagcccagacacacaaatggcttc ggttgaagaaattagaaatgcccaacgtgctcaaggtccagccaccattctagccataggcacagccaccccagctcattttatcaacc aggctgagtatcctgattactactttcgtatcacaaacagtgagcacaaaacagagttaaaagaaaaattcaagcgcatgtgtgataaat ccatgataaacaaac 12 2. Protein BLAST In protein BLAST tools, user must use the protein query as the sequence, and then NCBI will search the inserted query against the protein database. Figure 2.3 Protein BLAST interface Example of protein query: MSINIRDPLIVSRVVGDVLDPFNRSITLKVTYGQREVTNGLDL 13 3. BLASTX Blastx is another tool in BLAST. Firstly, user must insert a nucleotide query as the sequence then blastx will convert the query into six-reading frames protein sequences. After that, the translated query will be compared against NCBI protein databases and return the results if there are hits. This tool is advantageous when user trying to search homologous protein in a nucleotide coding region. Figure 2.4 Blastx interface 14 Figure 2.5: Sample blastx output * six-reading frames - (in sequence analysis) translation of a DNA sequence taking into account the three possible reading frames in each direction of the strand, giving rise to three forward (positive strand) and three reverse (negative strand) translations. Example: Input sequence: attgttgctacttct Reading frame: 123 at tgttgctacttct 1st reading frame: I V A T S 123 at tgttgctacttct 2nd reading frame: L L L L 123 at tgttgctacttct 3rd reading frame: C C Y F 15 4. Translated BLAST: tblastn Tblastn is the tools that used protein query that have been translated into six-reading frames then compares it against NCBI nucleotide database. Uses of this tools is to find homologous protein coding regions in nucleotide sequences that are not annotate such as the expressed sequence tags (ESTs) and draft genome record (HTG). Both EST and HTG are located in BLAST database respectively. EST EST is the short and single-read complementary DNA (cDNA) sequences which consist of biggest pool of sequence data for many organisms and portions of transcripts of genes that have not been characterized. HTG HTG is the draft sequences from many genome projects or biggest genomic clones. Figure 2.6 Translated BLAST: tblastn interface 16 Figure 2.7: Sample tblastn output 17 5. Translated BLAST: tblastx Tblastx is the tools that converts nucleotide query that have been inserted into six-reading frames protein sequence then compares it against NCBI nucleotide database. This tool detects potential frame-shift and ambiguities that may prevent open-reading frame (OFR) and also to identify potential proteins that are encoded by ESTs. Figure 2.8 Translated BLAST: tblastx interface Figure 2.9: Sample tblastx output 18 Summary/Comparison: Types of Types of Types of BLAST query / database sequences use Blastn Nucleotides Purpose Nucleotide - Normally used. Function - Useful tool for primer or short sequence search. - Identify similar query sequence - Directly compare from nucleotide query against nucleotide database. Blastp Peptides Protein - Normally used. - Directly compare from protein query against protein database. - Identify similar query sequence Blastx Translated Protein nucleotide - Identify similar protein sequence - Useful when identifying homologous protein (protein that having similar primary, secondary and tertiary structure) in a nucleotide coding region. - Useful for identifying of the unknown reading frame sequence. - More sensitive than blastn. Tblastn Peptides Translated - Identify similar protein nucleotide - Useful for identified homologous protein coding regions in unannotated nucleotide sequences. 19 Tblastx Translated Translated nucleotide nucleotide - Identify very distant - Useful tool for identified novel gene relationships between (pieces of DNA that have not been nucleotide sequences identified before as being genes). - Identify similar protein. - More sensitive than blastp. - Take long time to search because of it sensitivity and batch searching is not recommended. - Long query/sequences also not recommended. Importance of translation BLAST (blastx, tblastn and tblastx). 1. Firstly, protein sequences are better conserved than nucleotide sequences. 2. Results produced are more reliable and accurate when dealing with coding DNA. 3. Able to directly see the function of the protein sequence, since by translating the sequence of interest before searching often gives the annotated protein hits. 20 2.1 Advantage(s) and Disadvantage(s) of BLAST tools on net or computer 1. On net Advantage(s) • Disadvantage(s) User can freely use the database that has • been remotely hosted by NCBI. • User totally cannot use the customized database. Completely no setup or only little setup • Requires internet connection is required to manage the tools. 2. On computer Advantage(s) • Disadvantage(s) • Can Use a Customized Database. Requires some setup and computer expertise • • For UNIX user it is better suited to scripting or automation when performed large number of queries. • no internet connection 21 Expensive Additional note: http://pga.mgh.harvard.edu/Parabiosys/education/seminars/blast.pdf Useful links: 1. http://blast.ncbi.nlm.nih.gov/Blast.cgi?CMD=Web&PAGE_TYPE=BlastHome 2. http://www.ncbi.nlm.nih.gov/blast/html/BLASThomehelp.html 3. http://www.ncbi.nlm.nih.gov/blast/Why.shtml 22 3.0 BLAST Database Content A BLAST search has four components: query, database, program, and search purpose/goal. To discuss effective BLASTprogram selection, we first need to know what databases are available and what sequences these databases contain. in thissection, we will first take a look at the common BLAST databases. According to their content, they are grouped into nucleotideand protein databases. These databases and their detailed compositions are listed in the two tables below.NCBI also provides specialized BLAST databases such as the vector screening database, variety of genome databases fordifferent organisms, and trace databases. 23 24 25 Creating custom databases there are 3 step to make custom database;database; 1. fasta file is convert into a binary blast database. 2. change the blast.html so that the database can be selected at drop-down drop down menu 3. modified the blast.rc 26 1.Converting Converting a fasta file into a binary BLAST database A binary BLAST database is a collection of multiple files 1. .nhr 2. .nin 3. .nsq files They must be created from a fasta file in a terminal, using the BLAST+ toolkit, The legacy BLAST toolkit can be used to achieve the same goal, though the command line syntax differs. Enter the following into the terminal;terminal; 2.Adding Adding the custom database to the drop-down drop box To add a database to the drop-down drop down box, modify blast.html in a text editor After the HTML has been modified correctly, the custom database should be able to be found when viewing the blast page with an internet browser 27 3.Modifying blast.rc change the blast.rc file like below As many databases can be added space separated as required after each program. 28 4.0 How Blast Work 4.1 INTRODUCTION The BLAST programs improved the overall speed of searches while retaining good sensitivity.This is important as databases continue to grow.Blast first breaking the query sequence and database sequences into fragments of "words".Then Blast seeking matches between fragments of query and database. Whenever the algorithms find the “hit” (a match between a “word” and a database entry) ,the hit are extend in either direction in an attempt to generate an alignment with a score exceeding the threshold of "S". 4.2 BLAST Algorithm The BLAST programs are the comparison algorithms that are used to search sequence databases for optimal local alignments to a query.The algorithms : Scoring of matches done using scoring matrices Sequences are split into words • For protein sequence(default n=3) BLAST algorithm extends the initial “seed” hit into an HSP HSP = high scoring segment pair 3 Step Process of Blast 1. Make lookup (hash) table of query sequence 2. Scan database for hits 3. Extend hits that meet certain scoring criteria Figure of how blast work: 29 lookup table PROTEIN Query Sequence: MLTNSEFVSMWSAESCRTPLCSVNNSYFPGAL MLT NSE FVS….. LTN SEF VSM… TNS EFV SMW… BLAST STEP PROCESS 30 After making words for the sequence of interest.The neighborhood words are also assembled and these words must having a score at least the threshold T or greater than T. How to calculate neighborhood score threshold? By using Blossum 62 scoring Matrices Query Word: GTW Subject Word: GTW = 6 + 5 + 11 = 22 Query Word: GTW Subject Word: GSW = 6 + 1 + 11 = 18 Query Word: GTW Subject Word: ATW = 0 + 5 + 11 = 16 By comparing the each character in query words and Subject word,we get the value and sum up for the total score.For Example: Query Word= GTW and Subject Word=GTW 31 The first character in query word which is G are compared to the first character in subject word which is also G.Where are the value 6 are coming from?.The answer is coming from the Blossum 62 scoring matrix(refer figure 1 below).As you can see,the value where the intersection of two square which is in red colour in figure 1 are taken.The same step are apply to the second character and third character.The value which is 6,5 and 11 are sum and get the total of 22. The same step are also apply to the other words. Figure 1 Step 2: Scan the database for entries that match the lookup table fast and relatively easy. 32 Step 3: when manage to find a hit (a match between a “word” and a database entry), extend the hit in either direction. Keep track of the score (use Blossum 62 scoring matrix) Each time the alignment is extended, an aligntment score is increases or decreased. When the alignment score drops below a predefined threshold, the extension of the alignment stops Neighborhood Words Neighborhood can be Words with a score over a predefined threshold 33 Protein Blast http://blast.ncbi.nlm.nih.gov/Blast.cgi Click the protein blast from BLAST program 34 Page for protein Blast. Four components to a BLAST search: (1) Choose the sequence (query) (2) Select the BLAST program (3) Choose the database to search (4) Choose optional parameters Then click “BLAST” (1) Choose the sequence (query) 35 (2) Select the BLAST program 36 (3) Choose the database to search (4) Choose optional parameters Then click “BLAST 37 5.0 Interpretation of Blast Result NCBI blast can accept the inputs query sequence in form of FASTA format, GI or accession number. User should get a result page from NCBI blast after running the blast. So, this section will discuss about the interpretation of results from NCBI blast. The structure of result page will consist of summary, graphical overview, descriptions table and alignments section. Note : To explain the structure of result page in details, GI:17529185 is used as an example of blast in following sections. 5.1 Summary Figure 5.0 : Summary of Query Input This is the first part shown on the top of result page. Summary gives the overall descriptions of the input which are fasta sequence or accession number or GI numbers and database information. Information of fasta consists of RID, query ID, description, molecular type and query length. RID is the request ID that can be kept by user and use it to access the result page again whenever they need within the valid period. Query ID is an ID will be assign to the each input that user entered. Description is the description of input and will be shown if any. Molecule type is the type of molecule of input. Query length is the total length of the input. Database information indicates what database and program will be used in running the blast of the input entered. There will be consisting of database name, description and program. 38 5.2 Graphical Overview Figure 5.1 : Graphical Overview of Blast Result The graphical overview show the distribution of blast hits on query sequence. The numbered red bar at the top of the figure 5.1 is represent the query sequence while the number attached to the red bar is query coordinates. The alignment scores are defined by using color key. As can be seen from figure 5.1, alignment scores less than 40 is represented by black color key while alignment scores equal or more than 200 is represented by red color key. The most similar aligned sequence are shown closet to the query sequence. In this case, there are three aligned sequence are the most similar to the query sequence due to the high alignment score since its colored bar has red color key from query 1 to the end. In other words, the next following colored bars indicate the aligned sequence from database that match the query with lower score. Mouse over the bars displays the definition line which consist definition and 39 score for that aligned sequence to be shown in the window above the graphic as figure 5.2 shown. It will also show the alignment for that sequence if click on it. Figure 5.2 : Mouse Over On Graphical Overview 40 5.3 Description Table Figure 5.3 : Description Table for Blast Result The descriptions table provides a summary of the aligned sequence from database which identified by Blast to be similar to the input query. As can be seen from figure 5.3, from left to right, the descriptions table columns display the description, max score, total score, query cover, ident and accession. In traditional report format, this is known as one-line descriptions because each line in the table is composed of those seven fields which are description, max score, total score, query cover, ident and accession. Definition for each field Description Title of database sequence that matched to the query sequence. Max Score The maximum alignment score from that matched database sequence. Total Score The sum of all alignment scores of alignment segments. Query Cover The coverage (%) ofthe query sequence being aligned to the matched database sequence. E - value The lowest expect value from that matched database sequence. Ident The highest percentage of identityof all pairwise alignments between query and database sequences. Accession Accession number of database sequence that matched to the query sequence. 41 5.4 Alignments The alignments section contains the detailed pairwise alignments between query and subject sequence in database or we know as (Sbjct). Alignment section provides statistic line which composed of score, expect, identities, gap and strand for each pairwise alignment. Figure 5.4 : Alignment of Blast Result 42 Figure 5.5 : Alignment of Blast Result (2) Definition on Statistics Line Score Summed HSP (High Scoring Pair) score (S) Bit Score A normalized scorein bits(S’) Expect (E) Expected number of chance HSP aligns Identities Number and percentage of exact residue matches Gaps Number and percentage of gaps introduced 43 5.5 Score, bit Score and E-value Calculation 1.5.1 Score Score (S) is a number which can be used to evaluate the relevance of a finding in biology.A score is a numerical value that can tell the overall quality of an alignment in terms of sequence alignments. Higher numbers of score indicate higher similarity of alignment. The score scale for score calculation is relying on scoring system used which included substitution matrix and gap penalty. Overall, the score indicates that the higher the score, the best of the alignment. For nucleotides blast,same score (positive) is given to each identical match, and a penalty (negative) score is assigned to all mismatches. Since the scoring system may be varied from default according to different situation, but for the purpose of highlighting the occurrence of gaps and mismatches, the scoring system as below is used : Match (Positive) = +1 point Mismatch (Negative) = -2 points Gap opening (Negative) = -2 points Gap extension (Negative) = -1 point Example 1 : AAC GTT TCC AGT CCA AAT AGC TAG GC | | | .. | | | | .| | | . | | . | || | | | AAC CGT TCCAGT ACA ATT ACC TAG GC Matches (+1): 18 Mismatches (-2): 5 Gaps (opening -2, extension -1): 1, 2 Score (S) = 18 * (+1) + 5 * (-2) +1 * (– 2) + 2 * (-1) = 4 44 For amino acid (protein) blast, blosum62 substitution matrices are used to calculate score. BLOSUM is known as Blocks Substitution Matrix.This matrix claims that score (positive) or penalty score (negative) is given for each identical amino acid or substitution between two amino acids. As can be seem from figure 7, identities or substitutions are not allhave equal value. This is because blosum62 give a signification of the likelihood that a specific substitution may occur between many proteins. So, BLOSUM 62 is used as the default matrix in BLAST algorithm to calculate score for protein alignment. Gap opening scoring is -4 and extension is -1. Figure 7 : Blosum62 Substitution Matrix 45 Example 2 : Consider this pairwise sequence alignment: Query LENTFFVQANC Sbjct YENITIIQSNC The score is calculated by total up all the numbers from left to right as follows: Query L E N T F F V Q A N C Sbjct Y E N I T I I Q S N C Score -1 5 6 -1 -2 0 3 5 1 6 9 Score (S) = (-1) + 5 + 6 + (-1) + (-2) + 0 + 3 +5 +1 +6 + 9 = 31 How to get score form blosum62 ? 46 5.5.2 Bit-score Bit-score (S’) is a score(S) in log-scaled version. In BLAST, the bit-score (S')is a score being normalized and expressed in bits. Formulae to calculate bit-score : WhereS = score, λ and K = constant parameters depend on the scoring system used. Example 3 : As referred from Example 2, we know that the score is 31. For BLOSUM62 ,λ = 0.318 and K= 0.14. So, let substitutes the values into the equation to get the bit-score. S' = (λ S - ln K) / ln 2 = (0.318 * 31 - ln 0.14) / ln 2 = 17.0586(4s.f) 5.5.3 E – Value (E) E-value is an expectation value which reveals the expectation number of BLAST alignments with Score to be seen as a result of chance. It is efficient for searching large databases to know how easily (or rather uneasily)that an alignment could arise by chance. The higher the Score (more significant), the lower the E-value is. E-value and Score are related, but E-value contains more information. 47 Formulae to calculate E-value (E): E = mn 2-s' where m is the length of the subject sequence in database, n is the length of the query sequence and S' is the normalized score from above. Example 4 : As referred from Example 3, we know that the bit-score is 17.0586. Let assume that the length of the database sequence, m is 11 while the length of query sequence, n is 11. So, let substitutes the values into the equation to get the E-Value. E = mn2-s’ = 11 * 11 * 2-17.0586 = 8.86 x 10-04 There is another way to calculate E-value without having bit-score. E = K m n e-λS Where S is the score, λ and K are parameters that characterize the expected distribution of S for the scoring system used, m is the length of thesubject sequence indatabase andn is the length of the query sequence. Example 5 : As referred from Example 2, Score, S is 31, For BLOSUM62 ,λ = 0.318 and K= 0.14. Let assume the length ofsubject sequence indatabase, m is 11 and the length of the query sequence, n is 11. E = Kmne- λS = 0.14 * 11 * 11 * e-(0.318 * 31) = 8.86 x 10-04 48 5.5.4 Exercise 1. For nucleotides blast, you are given the substitution matrix scoring system as below : Gap opening = -2 Gap extension = -1 Calculate the score for each alignment pair : a) Query AATCGTGCCTTGGACCCCTCA Sbjct AATCCTGCCTTGGACCCGTCC b) Query TTACGCGCTCCGGAAAGATGG Sbjct TTACGC _CTCCGGACAGATG_ c) Query CGGGAGGCCAAAGATCTAAGC Sbjct C_ GGAGGCC__ _ GACCTAAGC Answer : a) 12 b) 12 c) 8 49 2. For protein blast, based on the blosum62 substitution matrix, find out the score and E-value for questions below. For BLOSUM62,λ = 0.318 and K= 0.14while m and n depend on the questions below. a) Query NLYENFVQATF Sbjct NYAENTIQSII b) Query LNCQEFVDTPG Sbjct VWCGFFADTPG C) Query CLASV-ETPMWP Sbjct CLTSLAQTPL-P Answer : a)score = 20 E-value = 0.0293 b) score = 31 E-value = 8.86 x 10-04 c) score = 33 E-value = 4.69 x 10-04 50