* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
Download Table 4.3: Binding energy between KRAS protein and
Neuropharmacology wikipedia , lookup
Discovery and development of direct Xa inhibitors wikipedia , lookup
Discovery and development of proton pump inhibitors wikipedia , lookup
Magnesium transporter wikipedia , lookup
Discovery and development of neuraminidase inhibitors wikipedia , lookup
Discovery and development of integrase inhibitors wikipedia , lookup
NK1 receptor antagonist wikipedia , lookup
Drug design wikipedia , lookup
Discovery and development of antiandrogens wikipedia , lookup
An in vitro studies on the inhibition of lung cancer proliferation using different natural antioxidants By 1. Murtada M. Hussein (Lecturer of Biotechnology, Al-mustaqbal University College, Babylon, Iraq, E-mail: [email protected]) 2. Saif Qahtan Salman (Lecturer of Biochemistry, College of Biotechnology, Al-Qasim Green University, Babylon, Iraq, E-mail: [email protected]) 3. Ghufran A. Abdulraheem (Lecturer of Zoology, College of Biotechnology, Al-Qasim Green University, Babylon, Iraq, E-mail: [email protected]) Al-Qasim Green University Iraq, 2015 ABSTRACT In this study, Kras protein sequence, stucture and functional analysis were performed. The mutation at 12th position changing the existing amino acid to arginine has been reported in lung cancer. The antioxidants selected for the study are Ascorbic acid, 3,7, dihydroxyflavone, isoflavone and quercetin. Antioxidants drug likeliness, toxicity are studied. The chemical structures of those antioxidants were studied to be used for binding to the mutational site of KRAS. Based on the binding efficiency the best antioxidant which can be used in lung cancer treatment is determined. Key words: Kras protein, antioxidants, ascorbic acid, 3,7, dihydroxyflavone, isoflavone, quercetin. INTRODUCTION RAS Mutations in NSCLC: The RAS gene family includes HRAS, KRAS and NRAS and encodes for membranebound 21-kd guanosine triphosphate (GTP) binding proteins regulating cell growth, differentiation and apoptosis by interacting with multiple effectors including mitogen-activated protein kinase (MAPK), phosphoinositide 3-kinase (PI3K) and signal transducer and activator of transcription (STAT) cascades (Figure 1). RAS proteins acquire transforming potential when a point mutation in the gene replaces an amino acid at position 12, 13 or 61 (Bos., 1998). These mutations lead to forms of RAS with impaired GTPase activity, causing a constitutive activation of RAS signalling pathway. Mutations in K-RAS gene occur frequently in NSCLC (Rodenhuis et al., 1987)., more frequently (20–30%) in adenocarcinoma and less frequently (about 7%) in squamous-cell carcinoma (Jemal et al.,2008). Figure 1: Ras activation/deactivation cycle by GEF (guanine exchange factors) and GAP (GTPase activating proteins). Types of antioxidants: 5.2.1 Ascorbic acid: Ascorbic acid or "vitamin C" is a monosaccharide antioxidant found in both animals and plants. As one of the enzymes needed to make ascorbic acid has been lost by mutation during human evolution, it must be obtained from the diet and is a vitamin. Most other animals are able to produce this compound in their bodies and do not require it in their diets. In cells, it is maintained in its reduced form by reaction with glutathione, which can be catalyzed by protein disulfide isomerase and glutaredoxins. Ascorbic acid is a reducing agent and can reduce and thereby neutralize, reactive oxygen species such as hydrogen peroxide. Luteolin Luteolin is a yellow crystalline compound. It is a flavonoid; to be specific, it is one of the more common flavones. From preliminary research, it is thought to play a role in the human body possibly as an antioxidant, a free radical scavenger, a promoter of carbohydrate metabolism, or an immune system modulator . If applicable to the human condition, these characteristics may inhibit cancer mechanisms. Basic research results indicate luteolin as an anti-inflammatory agent. with other potential effects on septic shock . It has been suggested for multiple sclerosis on the basis of in vitro work. THE CHEMISTRY OF ANTIOXIDANTS It involves the mechanism of action of antioxidant. Two principle mechanisms of action have been proposed for antioxidants. The first is a chain-breaking mechanism by which the primary antioxidants donate electrons to the free radicals present in the system, example lipid radicals. The second mechanism involves removal of ROS (reactive oxygen species) and RNS (reactive nitrogen species) initiator by quenching chain initiator catalyst. REVIEW OF LITERATURE EFFECTS OF ANTIOXIDANTS: A healthy cell has a mortal enemy which is called a "free radical." Free radicals constantly seek out healthy cells and attack their vulnerable outer membranes eventually causing cellular degeneration and death. Free radicals scientists today, carry out the actual destructive work in disease, in infection, in stress and in aging. Additionally, free radicals can negatively affect athletic performance by slowing or halting muscle growth and by lowering aerobic capacity. Further, free radicals are known to cause defects in normal RNA as well as in life perpetuating DNA, the genetic material of the cells (Warner et al., 2004). Many nutraceutical and health food companies sell formulations of antioxidants as dietary supplements and these are widely used in industrialized countries. These supplements may include specific antioxidant chemicals, like resveratrol (from grape seeds or knotweed roots), combinations of antioxidants, like the "ACES" products that contain _-carotene (provitamin A), vitamin C, vitamin E and selenium, or herbs that contain antioxidants - such as green tea and jiaogulan. Although some levels of antioxidant vitamins and minerals in the diet are required for good health, there is considerable doubt as to whether these antioxidant supplements are beneficial or harmful (Warner et al., 2004). Mutant KRAS inhibition by antioxidants The effects of the dietary phytochemicals quercetin(Q), luteolin(L) and ursolic acid (UA) on cell proliferation and apoptosis in two human CRC derived cell lines, HCT15 and CO115, harboring KRAS and BRAF activating mutations, respectively. In KRAS mutated HCT15 cells, Q and L significantly decreased ERK phosphorylation, whereas in BRAF mutated CO115 cells the three compounds decreased Akt phosphorylation but had no effect on phospho-ERK. These natural compounds have ant proliferative and proapoptotic effects and simultaneously seem to act on KRAS and PI3K but not on BRAF. These results shed light on the molecular mechanisms of action of Q, L and UA and emphasize the potential of dietary choices for the control of CRC progression (Xavier et al., 2009). Therapeutic strategies that target tumors harboring these mutations represent an unmet medical need. In this study, we investigated the relationship between antifolate sensitivity and KRAS mutation/amplification status in NSCLC. Human NSCLC cell lines (KRAS wild type, KRAS mutant non-amplified and KRAS mutant amplified) were treated with Methotrexate (MTX) or Pemetrexed (PEM) and assayed for proliferation. In these studies, KRAS wild type and KRAS mutant amplified cells showed resistance to MTX treatment (IC50 >10μM). In contrast, growth of all KRAS mutate non-amplified cell lines studied was inhibited with MTX treatment (IC50 <100nM). Similar effects were observed for PEM in this study (Moran et al., 2012). MATERIALS AND METHODS TOOLS AND DATABASES PUBMED: PubMed comprises more than 21 million citations for biomedical literature from MEDLINE, life science journals, and online books covering portions of the life sciences, behavioral sciences, chemical sciences, and bioengineering.It also provides access to additional relevant web sites and links to the other NCBI molecular biology resources. PDB: The Protein Data Bank (PDB) is a repository for the 3-D structural data of large biological molecules, such as proteins and nucleic acids.It contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. RCSB PDB curates and annotates PDB data according to agreed upon standards. RCSB PDB is used to perform simple and advanced searches based on annotations relating to sequence, structure and function, and to visualize, download, and analyze molecules. PubMed is a free resource that is developed and maintained by the National Center for Biotechnology Information (NCBI), at the U.S. National Library of Medicine (NLM), located at the National Institutes of Health (NIH). STRUCTURAL ANALYSIS TOOLS EXPASY ExPASy is the SIB Bioinformatics Resource Portal which provides access to scientific databases and software tools in different areas of life sciences including proteomics, genomics, phylogeny, systems biology, population genetics, transcriptomics. 1.PROTPARAM (Primary Structure Analysis) ProtParam is a tool which allows the computation of various physical and chemical parameters for a given protein stored in Swiss-Prot or TrEMBL or for a user entered sequence. The computed parameters include the molecular weight, theoretical pI, amino acid composition, atomic composition, extinction coefficient, estimated halflife, instability index, aliphatic index and grand average of hydropathicity (GRAVY). 2. SOPMA (Secondary structure analysis) SOPMA (Self-Optimized Prediction Method with Alignment) is an improvement of SOPM method. The improvent takes place in the fact that SOPMA takes into account information from an alignment of sequences belonging to the same family. If there are no homologous sequences the SOPMA prediction is the SOPM one. Tertiary Structure Analysis CPH Models : CPHmodels 3.2 is a protein homology modeling server. The template recognition is based on profile-profile alignment guided by secondary structure and exposure predictions. CPHmodels-3.0 is a web-server predicting protein 3D-structure by use of single template homology modeling. The server employs a hybrid of the scoring functions of CPHmodels-2.0 and a novel remote homology-modeling algorithm. A query sequence is first attempted modeled using the fast CPHmodels-2.0 profile-profile scoring function suitable for close homology modeling. DRUG DESIGNING TOOLS 1. ARGUS LAB ArgusLab is a free molecular modeling package that runs under windows, graphics. It is a drug designing program with 3D builder, ab initio calculation modules, and simple molecular mechanics. It also used for protein docking purposes. 2. PUBCHEM PubChem provides information on the biological activities of small molecules. PubChem includes substance information, compound structures, and BioActivity data in three primary databases, Pcsubstance, Pccompound, andPCBioAssay, respectively. It is maintained by NCBI. The compound structures and descriptive datasets can be freely downloaded. 3. DUNDEE PRODRG SERVER PRODRG takes a description of a small molecule (as PDB coordinates / MDL Molfile / SYBYL Mol2 file / text drawing) and from it generates a variety of topologies for use, as well as energy-minimized coordinates in a variety of formats. 4. ADME TOX ADME an acronym in pharmacokinetics and pharmacology for absorption, distributio n, metabolism, and excretion, and describes the disposition of a pharmaceutical compound within an organism. The four criteria all influence the drug levels and kinetics of drug exposure to the tissues and hence influence the performance and pharmacological activity of the compound as a drug. Mobyle is a system which provides an access to different software elements, in order to allow users to perform bioinformatics analyses. RESULTS AND DISCUSSIONS Kras protein MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC VKIKKCIIM Structure visualization using argus lab highlighting the mutational site G12D GEOMETRY Optimization: INFRENCE: using argus lab KRAS structure optimization was don. The energy of the protein structure is 1151.78 kcal/mol. BINDING RESULTS 3,7 Dihydroxyisoflavone: Binding results showed the binding KRAS protein mutation with antioxidant (3, 7 dihydroxyisoflavone) closely through the use of simulation system Argus lab. The high-energy showed the binding in this compound for two reasons, first, the high receptor for KRAS protein mutation, site (12D), second The high susceptibility of the 3,7 dihydroxyisoflavone . Figure 4.12: KRAS protein and 3,7dihydroxyisoflavone binding which are high binding energy: -6.63067kcal/mol. This shape explain the binding between 3,7dihydroxyisoflavone (violet color) and KRAS protein in site 12D (yellow color) Isoflavone: Isoflavone Binding results (Figure 4.14) showed the binding KRAS protein mutation with antioxidant Flavones closely through the use of simulation system Argus lab. The high-energy showed the binding in this compound for two reasons, first, the high receptor for KRAS protein mutation, site (12D), second The high susceptibility of the Flavones. Figure4.14: KRAS protein and Isoflavone binding appear high energy binding: 6.23017kcal/mol. This shape explain the binding between flavones (green color) and KRAS protein in site 12D (orange color) Ascorbic acid Ascorbic acid have high binding energy with KRAS protein in the activate 12D which are responsible about KRAS mutation. This binding (figure 4.13) showed the high ability for ascorbic acid to link with KRAS protein. Through used Agrus lab showed clear binding occurring between the antioxidants compounds with KRAS protein in the site 12D, This binding showed the antioxidants activity for inhibiting the KRAS mutation. Figure 4.13: KRAS protein and ascorbic acid binding appear high Binding Energy: -5.78191kcal/mol. This shape explain the binding between ascorbic acid (yellow color) and KRAS protein in site 12D (green color) Quercitin Quercitin have high binding energy with KRAS protein in the activate 12D which are responsible about KRAS mutation. This binding (Figure 4.15) showed the high ability for Quercitin to link with KRAS protein. Through used Agrus lab showed clear binding occurring between the antioxidants compounds with KRAS protein in the site 12D, this binding showed the antioxidants activity for inhibiting the KRAS mutation. Figure 4.15: KRAS and quercitin binding appear high Energy: -5.89287kcal/mol. This shape explain the binding between quercitin (violet color) and KRAS protein in site 12D (yellow color) Table 4.3: Binding energy between KRAS protein and Antioxidants compounds. Antioxidant 3,7 dihydroxyisoflavone Isoflavone Quercetin Ascorbic acid Protein structure Kras Kras Kras Kras Binding Energy -6.63067 kcal/mol -6.23017 kcal/mol -5.89287 kcal/mol -5.78191 kcal/mol SUMMARY AND CONCLUSION From the computational analysis, Kras protein was found to be hydrophilic, Aliphatic, Stable, negatively charged having the PI 6.33 and molecular weight 21655.8 daltons. Antioxidants (Ascorbic acid, 3,7, dihydroxyflavone, Isoflavone and Quercetin) were tested for drug likeliness and toxicity. From the binding energies between the mutational site 12D and the various antioxidants, the antioxidant named 3,7, dihydroxyIsoflavone showed the efficient binding -6.63067 kcal/mol, when compared with other antioxidants. Thus 3, 7 dihydroxyisoflavone can be taken as an effective antioxidant in the inhibition of Lung cancer proliferation. REFERENCES Bos, J. L. (1989): Ras oncogenes in human cancer: a review. Cancer Research 49 (17): 4682-4689. Rodenhuis, S., Van, D., Wetering, M., and Mooi, W. (1987): Mutational activation of the KRAS oncogene. A possible pathogenic factor in adenocarcinoma of the lung. New England Journal of Medicine 317 (15): 929–935. Jemal, A., Siegel, R. and Ward, E. (2008): Cancer statistics, 2008. CA Cancer Journal for Clinicians 58 (2): 71-96. Wender, R., Fontham, E. and Barrera, E. (2013): American Cancer Society lung cancer screening guidelines: CA Cancer Journal for Clinicians 63 (2): 107-117. Xavier, C., Lima, C., Preto, A., Seruca, R., Fernandes, Ferreira, M., and Pereira- Wilson, C. (2009): Luteolin, quercetin and ursolic acid are potent inhibitors of proliferation and inducers of apoptosis in both KRAS and BRAF mutated human colorectal cancer cells. Cancer Lett 28 (2):162-170. Moran, D. M., Patricia, T., Scott A., Shell, D., Ross C., Robert C., Doebele, E., Berge, M. and Sarah, B. (2012): KRAS mutation and amplification status predicts sensitivity to antifolate therapies in non-small-cell lung cancer. American Association for Cancer Research 72 (8):1158-1538. Ashutosh, K., Bhutani, R., Bal, A., Guleria, S. and Mohan, P. (2005): Chemotherapy alone vs. chemotherapy plus high dose multiple antioxidants in patients with advanced non-small cell lung cancer. Journal of the American College of Nutrition. 24 (1): 16-21. Bach, P. B., Hanger, M., Jett, J. R. and Silvestri, G. A. (2007): Screening for lung cancer: ACCP evidence based clinical practice guidelines. Chest 132 (3): 69-77. Balsano, C. and Alisi, A. (2009): Antioxidant effects of natural bioactive compounds. Current pharmaceutical design. 15 (26): 3063-3073.