* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
Download Chem4050_lecture1_2017-22xcfkp
Molecular Hamiltonian wikipedia , lookup
Nitrogen-vacancy center wikipedia , lookup
History of quantum field theory wikipedia , lookup
Hidden variable theory wikipedia , lookup
Canonical quantization wikipedia , lookup
Aharonov–Bohm effect wikipedia , lookup
Quantum state wikipedia , lookup
EPR paradox wikipedia , lookup
Bell's theorem wikipedia , lookup
Theoretical and experimental justification for the Schrödinger equation wikipedia , lookup
Hydrogen atom wikipedia , lookup
Nuclear force wikipedia , lookup
Relativistic quantum mechanics wikipedia , lookup
Symmetry in quantum mechanics wikipedia , lookup
Spin (physics) wikipedia , lookup
Electron paramagnetic resonance wikipedia , lookup
GSU Chem 4050/6050 Lecture 1 Feb 28,2017 PSC 311 Zhenming (Jimmy) Du Round Robin Instructor: Dr. Zhenming (Jimmy) Du NSC 134A Email: [email protected] Phone: 404-413-5538 Web: sites.gsu.edu/zdu Students: Scope of Chem 4050/6050: Level I Chem 4050/6050. Introduction to Fourier-Transform NMR Spectroscopy. Prerequisites: demonstrated research need and approval of the departmental chair. Introduction to techniques of Fourier-Transform Nuclear Magnetic Resonance Spectroscopy Next step: Level II Fall Semester Chem 8450, NMR Spectroscopy (4) Prerequisite: Chem 6050 or consent of the instructor. Theory and application of NMR spectroscopy for the characterization and elucidation of organic and biological molecules. Next step: Level III Spring semester: Chem 8540. Biomolecular Nuclear Magnetic Resonance. (3) Prerequisite: Introductory courses in spectroscopy, such as Chem 4050/6050 and Chem 4190/6190 or equivalent. Some experience in the application of quantum mechanics in spectroscopy is useful, but not essential. Experimental design and interpretation of nuclear magnet resonance data, particulary with respect to applications in structural biology. Textbook required Edition: 2nd ISBN-13: 978-0198703419 ISBN-10: 0198703414 Helpful Books This text is aimed at people who have some familiarity with high-resolution NMR and who wish to deepen their understanding of how NMR experiments actually ‘work’. This revised and updated edition takes the same approach as the highly-acclaimed first edition. The text concentrates on the description of commonly-used experiments and explains in detail the theory behind how such experiments work. The quantum mechanical tools needed to analyse pulse sequences are introduced set by step, but the approach is relatively informal with the emphasis on obtaining a good understanding of how the experiments actually work. The use of two-colour printing and a new larger format improves the readability of the text. Helpful Books This work-book will guide you safely, in step-by-step descriptions, through every detail of the NMR experiments within, beginning with 1D routine experiments and ending with a series of advanced 3D experiments on a protein: Topics today NMR Basics: Theory for NMR detection; Concerns during NMR detection. Reading assignment: 1. Lecture 1 notes; 2. Chapter 1 & 2; 3. Read gsuNMR guide before lab 1; 4. Reading NMR operation procedures. 1. What is NMR? NMR = Nuclear Magnetic Resonance About MRI (N)MRI = (Nuclear) Magnetic Resonance Imaging NMR Applications NMR Applications Organic Structure Illustration:Heparin Protein Structure Illustration 2LCJ CFPGDTRILVQIDGVPQKITLRELYELFED ERYENMVYVRKKPKREIKVYSIDLETGKV VLTDIEDVIKAPATDHLIRFELEDGRSFETT VDHPVLVYENGRFIEKRAFEVKEGDKVL VSELELVEQSSSSQDNPKNENLGSPEHD QLLEIKNIKYVRANDDFVFSLNAKKYHNV IINENIVTHQ Du, Z., Liu, J., Albracht, C.D., Hsu, A., Chen, W., Marieni, M.D., Colelli, K.M., Williams, J.E., Reitter, J.N., Mills, K.V., Wang, C. Journal: (2011) J.Biol.Chem. 286: 38638-38648 Nuclear=? Atoms are made of electrons and nuclei. Each atomic nucleus has four important physical properties: mass, electric charge, magnetism, and spin. Mass, electric charge: more sensible Nuclear magnetism and spin: less tangible ( but need to understand here) Quantum mechanics treatment Nucleus have numbers(n,l,ms,s) four quantum n: Principle quantum number(n): the size of the orbital (1,2,3,…,n) l: Angular quantum number (l): the shape of the orbital (0, 1, …, n-1)(s,p,d,f,…) ms: Magnetic quantum number(m):orientation in space of a particular orbital [-l, …,-2,-1,0,1,2,…,l] s: Nucleus has an intrinsic spin angular momentum ( hence spin quantum number, I). Nuclear Spin Some nuclei possess an intrinsic angular momentum Nuclear spin angular momentum is quantized in integer multiples of h/2π(or h is Planck’s constant) Maximum observable component p of nuclear spin angular momentum is p= I * h/2 π I = nuclear spin quantum number I varies as a result of the interactions between protons and neutrons Nuclear spin differs from electron spin both quantized, I ≠ 0: Nmrable Nuclear spin differs from electron spin both quantized, I ≠ 0: Nmrable I Nuclide 0 12C 16O 1/2 1H 13C 1 2H 14N 3/2 11B 23Na 5/2 17O 27Al 3 10B 15N 19F 35Cl 37Cl 29Si, 31P Example: ν = γ * B0/ 2π For proton , γ = 26.7519 * 107 rad T-1 S-1 For carbon, γ = 6.73 * 107 rad T-1 S-1 T: Telsa = 10,000 Gauss B0= 9.40T, corresponds to 400MHz NMR for proton. corresponds to NMR for carbon. B0= 11.45T, corresponds to Bo = NMR; , corresponds to 600 MHz NMR; Commercially available magnetic field 1.4T------22.31 60MHz-950 MHz This lies on the radiofrequency range (RF) of the electromagnetic spectrum. Resonance along is not enough Detecting the resonance is the key! Low energy range! Radio frequency range! At room temp, the number of spins in the lower energy level (N+)is slightly greater than the number in the upper level (N-). The Boltzmann Factor and Partition Functions The Boltzmann factor tells us that if a system has states with energies E1, E2, E3,. …, the probability Pj that the system will be in the state with energy Ej depends exponentially on the energy of that state, or Pj ∝ 𝑒 −𝐸𝑖/𝐾𝑏𝑡 At room temp, the number of spins in the lower energy level (N+)is slightly greater than the number in the upper level (N-). NMR Detection Key Elements 1. A strong magnetic field; 2. RF pulse to excite nuclei in the sample; 3. Detection of the feedback (NMR signal). 1. A strong magnetic field; Superconduc ting solenoid; 2. RF pulse Δ𝐸 = ℎ𝑣 = γℏ𝐵0 Twist between 𝑣 and 𝐵0 to achieve balance; For protons, if you supply a magnetic field B0, then all protons will appear in the same frequency 𝑣 as γ 𝑎𝑛𝑑 ℏ 𝑎𝑟𝑒 𝑎𝑙𝑙 𝑐𝑜𝑛𝑠𝑡𝑎𝑛𝑡𝑠? . • 1926 Pauli’s prediction of nuclear spin! • 1932 Detection of nuclear magnetic moment by Stern using molecular beam! – 1936 First theoretical prediction of NMR by Gorter; his attempt to detect the first NMR did not work (LiF &K[Al(SO4)2]12H2O) at low temp. • 1945 First NMR of solution (Bloch et al for H2O) and solids (Purcell et al for parafin)! • 1949 Discovery of chemical shifts! NMR Sensitivity. Relative sensitivity S/N ∝ γ3 Absolute Sensitivity S/N ∝ γ3 * C C stands for natural abundance. Pulse NMR is fast 20ppm at 400MHz= 8000Hz, 125us for 360 pulse 20ppm at 800MHz=16000Hz, 62.5 us for 360 pulse Exercises Now you are running NMR on 500Mhz NMR, and you found your 90 pulse for proton is 12 μs long. Your lab mate told you he has peaks that appears between 5 ppm and 0 ppm. Is the pulse strong enough to cover that range? What about a spectrum between 40ppm and -10 ppm? RF Pulses 3. Chemical Shift Earth’s magnetic field Refrigerator magnet MRI medical scanners High field NMR magnet 200 MHz 400 MHz 500 MHz 800 MHz 0.6 Gauss at equator 100 - 150 Gauss 0.3 - 1.5 Tesla (3 - 15,000 G) 4.7 Tesla (47,000 G) 9.4 Tesla (94,000 G) 11.7 Tesla (117,000 G) 18.8 Tesla (181,000 G) Proton peaks are isolated Chemical Shift 𝐵𝑙𝑜𝑐 =𝐵0 (1-σ) Chemical Shift Chemical Shift Chemical Shift CH4 CH3Cl CH2Cl2 CHCl3 δ=0.23 δ=3.05 δ=5.33 δ=7.26 CH3I CH3Br CH3Cl CH3F δ=2.16 δ=2.68 3.05 4.26 Chemical Shift Chemical Shift Chemical Shift Advantage of FT-NMR vs. CW • Faster speed. No sweeping needed. 1 s/ scan vs. 4500s / scan • Multiple scan to improve S/N; • Spin Manipulation for complicated NMR experiments, such as water suppression, NOESY, and HMBC.