• Study Resource
  • Explore Categories
    • Arts & Humanities
    • Business
    • Engineering & Technology
    • Foreign Language
    • History
    • Math
    • Science
    • Social Science

    Top subcategories

    • Advanced Math
    • Algebra
    • Basic Math
    • Calculus
    • Geometry
    • Linear Algebra
    • Pre-Algebra
    • Pre-Calculus
    • Statistics And Probability
    • Trigonometry
    • other →

    Top subcategories

    • Astronomy
    • Astrophysics
    • Biology
    • Chemistry
    • Earth Science
    • Environmental Science
    • Health Science
    • Physics
    • other →

    Top subcategories

    • Anthropology
    • Law
    • Political Science
    • Psychology
    • Sociology
    • other →

    Top subcategories

    • Accounting
    • Economics
    • Finance
    • Management
    • other →

    Top subcategories

    • Aerospace Engineering
    • Bioengineering
    • Chemical Engineering
    • Civil Engineering
    • Computer Science
    • Electrical Engineering
    • Industrial Engineering
    • Mechanical Engineering
    • Web Design
    • other →

    Top subcategories

    • Architecture
    • Communications
    • English
    • Gender Studies
    • Music
    • Performing Arts
    • Philosophy
    • Religious Studies
    • Writing
    • other →

    Top subcategories

    • Ancient History
    • European History
    • US History
    • World History
    • other →

    Top subcategories

    • Croatian
    • Czech
    • Finnish
    • Greek
    • Hindi
    • Japanese
    • Korean
    • Persian
    • Swedish
    • Turkish
    • other →
 
Profile Documents Logout
Upload
Chapter_25_Metabolism
Chapter_25_Metabolism

... body cells via blood circulation. They are also called “bad cholesterol” because in high amounts they may deposit cholesterol around blood vessels. (25% protein) – High-density lipoproteins (HDLs): they remove excess cholesterol from cells and send to the liver for elimination. “Good cholesterol” (4 ...
electroporation
electroporation

... It is the client’s responsibility to design and engineer the targeting construct. The targeting construct is introduced into ES cells by electroporation; the clones grow under positive selection by antibiotics and several hundred resistant clones are picked into 96-well plates. The clones are splitt ...
Extraction rowing Cells and DNA G
Extraction rowing Cells and DNA G

... acclimating to their new surroundings by changing their membrane, producing new proteins, etc. In the transition from one medium to another container with the same medium, the lag phase will usually be very short. When transitioning from one medium to a different medium, the lag phase tends to be lo ...
Aminoacids_followup
Aminoacids_followup

... Amino acids with hydroxyl group In biology hydroxyl groups –OH are important as they can be modified by different molecules as phosphate (-PO4) or a long range of ...
Gene Section MIR296 (microRNA 296) Atlas of Genetics and Cytogenetics
Gene Section MIR296 (microRNA 296) Atlas of Genetics and Cytogenetics

... In squamous cell carcinomas of the esophagus, miR296 is reported to be over-expressed and to have a protumorigenic role. High levels of miR-296 are associated with resistance to chemotherapy, while its forced down-regulation resulted in increased sensitivity to standard chemotherapeutic agents and i ...
somatic cell nuclear transfer
somatic cell nuclear transfer

- DoctorSaputo.com
- DoctorSaputo.com

... today. Usually Fluorouracil (5-FU), Cisplatinum, Taxol, Vincristine and their derivatives are the favourites. They will delay some trouble but will not heal the patient. Unfortunately, one of the side effects of today’s treatment is the destruction of the body’s own defence system. Many patients wil ...
Mitosis - Fort Bend ISD
Mitosis - Fort Bend ISD

... remains closely associated. These are called sister chromatids. Crossing-over can occur during the latter part of this stage. ...
Cell Transport (Bio I) - Effingham County Schools
Cell Transport (Bio I) - Effingham County Schools

... 2. Facilitated diffusion: diffusion of specific particles through transport/carrier proteins found in the membrane a.Transport Proteins are specific – they “select” only certain molecules to cross the membrane b.Transports larger or charged molecules ...
Ligation and Transformation
Ligation and Transformation

... LB + amp + ara: Should contain only cells with the amp-resistant pGLO plasmid; colonies floresce green (+pGLO) ...
Objectives • Explain the "one gene–one polypeptide" hypothesis
Objectives • Explain the "one gene–one polypeptide" hypothesis

... stands for methionine (Met), but also functions as a signal to "start" translating an RNA transcript. There are also three "stop" codons that do not code for amino acids, but signal the end of each genetic message. This same genetic coding system is shared by almost all organisms. In experiments, ge ...
Document
Document

... TELKEGFHMEEKDEPIQEDDQVVGTIQKYTKQKWYAEVMYRFIDGSYFQHITLIDSGADVNCIREDEILDQLVQTKREQV VNSIYLHDNSFPKSMDLPDQKITEKRAKLQDIPHHEERLLDYREKKSRDGQDKLPMEVEQSMATNKNTKILLRAWLLST ...
Anti-Hsp70 antibody [EP1007Y] (HRP)
Anti-Hsp70 antibody [EP1007Y] (HRP)

... In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative confo ...
File - Achromatopsia
File - Achromatopsia

... proteins primary function revolving around vision [4]. It is also a mystery how well conserved the regulation of CNGA3 via its binding partners are, in species with and without eyes. EMILIN1 is one binding partner of CNGA3 that the functional conservation among species is unknown [5]. It is known th ...
Rough Endoplasmic Reticulum (RER)
Rough Endoplasmic Reticulum (RER)

...  The endoplasmic reticulum is a network of folded membranes that form channels. ...
Cell Biology Unit
Cell Biology Unit

... 1.2e - The organs and systems of the body help to provide all the cells with their basic needs. The cells of the body are of different kinds and are grouped in ways that enhance how they function together. 1.2f - Cells have particular structures that perform specific jobs. These structures perform t ...
1 - Port Fest Baltimore
1 - Port Fest Baltimore

... 7. Diffusion can be defined as particles moving: A. from left to right. B. from right to left. C. from an area of high concentration to an area of low concentration. D. from an area of low concentration to an area of high concentration. ...
H4(D10S170) è stato identificato perché riarrangiato con il
H4(D10S170) è stato identificato perché riarrangiato con il

... portion arrested with 4N DNA content, as observed by Facs analysis. These results demonstrate that H4 plays an important role in the prevention of polyploidy. This effect is neither drug nor cell specific. As H4-silenced cells endoreduplicate, it is clear that the polyplody checkpoint is compromised ...
Additional Biology B2 Core Knowledge
Additional Biology B2 Core Knowledge

... functions. Enzymes are proteins A change in the sequence of a DNA strand, meaning that different proteins are made at protein synthesis It may be harmful, beneficial or have no effect at all Protein may have:  different amino acids  different order of amino acids  a different shape/structure  a ...
What is biochemistry?
What is biochemistry?

... how cells communicate with each other. This helps us to understand how our bodies grow and develop, how our immune system works and how our cells repair themselves when they get damaged. Structure and function: An important part of biochemistry is understanding how the 3D shape, or structure, of mol ...
Polypeptide: alpha-helix and beta
Polypeptide: alpha-helix and beta

...  alpha-helix and beta-sheet models made by Prof. Ewing Procedure: Models may be used to help explain secondary protein structure. Related Information: Fibrous proteins are stringy, tough, and usually insoluble in water. Many fibrous proteins are involved with the structural parts of an organism. Al ...
Cells
Cells

... that help the cell stay alive. Plant cells and animal cells are two types of eukaryotic cells. These two types of cells have many cell parts in common. But plant cells and animal cells also have cell parts that are different. Compare the plant cell in Figure 1 and the animal cell in Figure 2 to see ...
multiplication and variation of viruses
multiplication and variation of viruses

enzymes are proteins
enzymes are proteins

... • Atom: The smallest unit of matter. Consists of a nucleus surrounded by electrons. • Molecule: The smallest unit of an element or compound, made up of two or more atoms held together by strong chemical bond. • Macromolecule: A large complex molecule, such as nucleic acids, proteins, carbohydrates, ...
Do Now: Wednesday, March 19
Do Now: Wednesday, March 19

< 1 ... 133 134 135 136 137 138 139 140 141 ... 262 >

Cell-penetrating peptide



Cell-penetrating peptides (CPPs) are short peptides that facilitate cellular uptake of various molecular cargo (from nanosize particles to small chemical molecules and large fragments of DNA). The ""cargo"" is associated with the peptides either through chemical linkage via covalent bonds or through non-covalent interactions. The function of the CPPs are to deliver the cargo into cells, a process that commonly occurs through endocytosis with the cargo delivered to the endosomes of living mammalian cells.CPPs hold great potential as in vitro and in vivo delivery vectors for use in research and medicine. Current use is limited by a lack of cell specificity in CPP-mediated cargo delivery and insufficient understanding of the modes of their uptake.CPPs typically have an amino acid composition that either contains a high relative abundance of positively charged amino acids such as lysine or arginine or has sequences that contain an alternating pattern of polar/charged amino acids and non-polar, hydrophobic amino acids. These two types of structures are referred to as polycationic or amphipathic, respectively. A third class of CPPs are the hydrophobic peptides, containing only apolar residues, with low net chargeor have hydrophobic amino acid groups that are crucial for cellular uptake.The first CPP was discovered independently by two laboratories in 1988, when it was found that the trans-activating transcriptional activator (TAT) from human immunodeficiency virus 1 (HIV-1) could be efficiently taken up from the surrounding media by numerous cell types in culture. Since then, the number of known CPPs has expanded considerably and small molecule synthetic analogues with more effective protein transduction properties have been generated.
  • studyres.com © 2026
  • DMCA
  • Privacy
  • Terms
  • Report