• Study Resource
  • Explore Categories
    • Arts & Humanities
    • Business
    • Engineering & Technology
    • Foreign Language
    • History
    • Math
    • Science
    • Social Science

    Top subcategories

    • Advanced Math
    • Algebra
    • Basic Math
    • Calculus
    • Geometry
    • Linear Algebra
    • Pre-Algebra
    • Pre-Calculus
    • Statistics And Probability
    • Trigonometry
    • other →

    Top subcategories

    • Astronomy
    • Astrophysics
    • Biology
    • Chemistry
    • Earth Science
    • Environmental Science
    • Health Science
    • Physics
    • other →

    Top subcategories

    • Anthropology
    • Law
    • Political Science
    • Psychology
    • Sociology
    • other →

    Top subcategories

    • Accounting
    • Economics
    • Finance
    • Management
    • other →

    Top subcategories

    • Aerospace Engineering
    • Bioengineering
    • Chemical Engineering
    • Civil Engineering
    • Computer Science
    • Electrical Engineering
    • Industrial Engineering
    • Mechanical Engineering
    • Web Design
    • other →

    Top subcategories

    • Architecture
    • Communications
    • English
    • Gender Studies
    • Music
    • Performing Arts
    • Philosophy
    • Religious Studies
    • Writing
    • other →

    Top subcategories

    • Ancient History
    • European History
    • US History
    • World History
    • other →

    Top subcategories

    • Croatian
    • Czech
    • Finnish
    • Greek
    • Hindi
    • Japanese
    • Korean
    • Persian
    • Swedish
    • Turkish
    • other →
 
Profile Documents Logout
Upload
Gene Technology
Gene Technology

...  A set of experimental methods used to assemble ...
GROUP 4 XERODERMA PIGMENTOSUM INTRODUCTION Xeroderma pigmentosum
GROUP 4 XERODERMA PIGMENTOSUM INTRODUCTION Xeroderma pigmentosum

... small amounts of sunlight. These often occur during a child's first exposure to sunlight. Development of many freckles at an early age  Skin Cancer Eyes that are painfully sensitive to the sun and may easily become irritated and bloodshot ...
What do genes do? - The Open University
What do genes do? - The Open University

... There is a third important structural difference between DNA and RNA. Recall that the basic structure of DNA is a double helix of two spiralled strands, i.e. it is double-stranded. In contrast, RNA is usually a single strand, as shown diagrammatically in Figure 2. The similarities in structure betwe ...
primary structure
primary structure

... • a polynucleotide forms when the phosphate of one nucleotide bonds to the sugar of the next nucleotide • DNA double helix-two polynucleotide strands wrap around each other – The two strands are associated because particular bases always hydrogen bond to one another – A pairs with T, and C pairs wit ...
First Semester Final Exam Study Guide
First Semester Final Exam Study Guide

... 1. What is the central dogma? 2. What is transcription? 3. What is translation? 4. What is the structure of DNA? What is the structure of RNA? What is the structure of a protein? 5. What is a nucleotide? What does a nucleotide have to do with DNA and RNA? 6. Name an enzyme that helps carry out the c ...
Macs Notes
Macs Notes

... attached. Cellulose and chitin are STRUCTURAL polymers made with one type of glucose. Glycogen and starch are ENERGY polymers made with the other form of starch.  Who cares? Cellulose and chitin are used in plants and animals respectively for constructing cell walls and exoskeletons. We (plants and ...
Gene Mutation, DNA Repair, and Transposition
Gene Mutation, DNA Repair, and Transposition

...  Induced mutations occur due to environmental factors o ...
Protein Synthesis and Processing
Protein Synthesis and Processing

... 44. There are 64 possible codons, with 61 of the 64 actually coding for amino acids and the other three serving as stop signals. There are only 20 known amino acids. Why is it beneficial to living organisms to have multiple codons that all code for the same amino acid? If more than one codon can cod ...
Banana DNA Extraction Lab
Banana DNA Extraction Lab

... 4. What happened when you added the detergent to the filtrate? ...
Pairwise Alignments Part 1
Pairwise Alignments Part 1

... QTKQDLELPKLAGTWHSMAMA-TNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWEN 81 ...
View Presentation
View Presentation

... This technique has been shown to provide the basis for High-Throughput Screening of therapeutic agents against Anthax toxins NIST & Ft. Detrick (USAMRIID & NCI) collaboration: Halverson, K.M, R.G. Panchal, T.L. ...
chapter 25 tortora
chapter 25 tortora

... DNA Replication • DNA Replication is semi-conservative • Resulting DNA is half-old, half-new • Parental DNA (template) and newly synthesized DNA ...
macromolecules tabel notes
macromolecules tabel notes

... (carbon based molecules) ...
gelfand-genetic-code
gelfand-genetic-code

... – Degenerate (many codons for one amino acid) – Comma-less (no specific markers between codons) ...
Chapter 12: DNA & RNA
Chapter 12: DNA & RNA

... attachment site • Does the order of amino acids matter? Yes, they must be in order for the protein to fold correctly. ...
Name: Cell Biology Test #1: 50 points
Name: Cell Biology Test #1: 50 points

... 16) a) True b) False: The same transcription factors are expressed at the same level in all eukaryotic cells. 17) Addition of ubiquitin to nascent _________causes its half life to be _____________. a) RNA, decreased b) RNA, increased c) protein, decreased d) protein, increased 18) a) True b) False: ...
Chapter 31: Epigenetic Effects Are Inherited
Chapter 31: Epigenetic Effects Are Inherited

... – Not a mutation or change in DNA sequence ...
biocp_mar20
biocp_mar20

Physical Science EOC Review Name
Physical Science EOC Review Name

... b. What is the primary function of the first enzyme (helicase)? ...
Document
Document

... Enzymes can become denatured when the environment they are in changes. can be due to a change in temperature, pH, or salinity. ...
Lecture 11 Analysis of Gene Sequences Anatomy of a bacterial
Lecture 11 Analysis of Gene Sequences Anatomy of a bacterial

Gene Mutations
Gene Mutations

... met thr try pro stop O THR still codes for THR O There is no example of a silent mutation because it does not affect the organisms phenotype. ...
31.8 res high NS
31.8 res high NS

... Can DNA be improved on? Although it is prodigious at encoding genetic information, it does so with an alphabet of only four letters. If this alphabet were extended, more information could be stored. Ichiro Hirao and Shigeyuki Yokoyama at the RIKEN Genomic Sciences Center in Yokohama, Japan, and thei ...
Answer Key - Test Banks Shop
Answer Key - Test Banks Shop

... 20. Which of the following substances is classified as a lipid? A) fatty acid B) amino acid C) nucleic acid D) ribose 21. Increased blood concentration of which one of the following substances is a risk factor for the development of coronary artery disease? A) albumin B) cholesterol C) hemoglobin D) ...
coding and non-coding functions of the genome
coding and non-coding functions of the genome

... “More than 80% of DNA is transcribed to non-coding RNA,” explained Tony Kouzarides, professor of cancer biology at the University of Cambridge. “And nearly half of that DNA is retrovirus inserted into the genome at some point of evolution,” added Simon J. Elsäser of Karolinska Institutet in Stockhol ...
< 1 ... 656 657 658 659 660 661 662 663 664 ... 1036 >

Nucleic acid analogue



Nucleic acid analogues are compounds which are analogous (structurally similar) to naturally occurring RNA and DNA, used in medicine and in molecular biology research.Nucleic acids are chains of nucleotides, which are composed of three parts: a phosphate backbone, a pucker-shaped pentose sugar, either ribose or deoxyribose, and one of four nucleobases.An analogue may have any of these altered. Typically the analogue nucleobases confer, among other things, different base pairing and base stacking properties. Examples include universal bases, which can pair with all four canonical bases, and phosphate-sugar backbone analogues such as PNA, which affect the properties of the chain (PNA can even form a triple helix).Nucleic acid analogues are also called Xeno Nucleic Acid and represent one of the main pillars of xenobiology, the design of new-to-nature forms of life based on alternative biochemistries.Artificial nucleic acids include peptide nucleic acid (PNA), Morpholino and locked nucleic acid (LNA), as well as glycol nucleic acid (GNA) and threose nucleic acid (TNA). Each of these is distinguished from naturally occurring DNA or RNA by changes to the backbone of the molecule.In May 2014, researchers announced that they had successfully introduced two new artificial nucleotides into bacterial DNA, and by including individual artificial nucleotides in the culture media, were able to passage the bacteria 24 times; they did not create mRNA or proteins able to use the artificial nucleotides. The artificial nucleotides featured 2 fused aromatic rings.
  • studyres.com © 2026
  • DMCA
  • Privacy
  • Terms
  • Report