• Study Resource
  • Explore Categories
    • Arts & Humanities
    • Business
    • Engineering & Technology
    • Foreign Language
    • History
    • Math
    • Science
    • Social Science

    Top subcategories

    • Advanced Math
    • Algebra
    • Basic Math
    • Calculus
    • Geometry
    • Linear Algebra
    • Pre-Algebra
    • Pre-Calculus
    • Statistics And Probability
    • Trigonometry
    • other →

    Top subcategories

    • Astronomy
    • Astrophysics
    • Biology
    • Chemistry
    • Earth Science
    • Environmental Science
    • Health Science
    • Physics
    • other →

    Top subcategories

    • Anthropology
    • Law
    • Political Science
    • Psychology
    • Sociology
    • other →

    Top subcategories

    • Accounting
    • Economics
    • Finance
    • Management
    • other →

    Top subcategories

    • Aerospace Engineering
    • Bioengineering
    • Chemical Engineering
    • Civil Engineering
    • Computer Science
    • Electrical Engineering
    • Industrial Engineering
    • Mechanical Engineering
    • Web Design
    • other →

    Top subcategories

    • Architecture
    • Communications
    • English
    • Gender Studies
    • Music
    • Performing Arts
    • Philosophy
    • Religious Studies
    • Writing
    • other →

    Top subcategories

    • Ancient History
    • European History
    • US History
    • World History
    • other →

    Top subcategories

    • Croatian
    • Czech
    • Finnish
    • Greek
    • Hindi
    • Japanese
    • Korean
    • Persian
    • Swedish
    • Turkish
    • other →
 
Profile Documents Logout
Upload
Rhizobiales-like protein phosphatases (Rhilphs): A role in plant
Rhizobiales-like protein phosphatases (Rhilphs): A role in plant

... Unlike Rhilph-1, there was no clear indication for functional associations of Rhilph-2 in the CressExpress analysis. No overlap was found among the genes co-expressed with the two Rhilphs, however both sets included genes for functionally related proteins, namely glutathione Stransferases, enzymes i ...
4e57127844fa884
4e57127844fa884

... especially ions, is due to their association with water molecules ...
protein synthesis
protein synthesis

...  More than 95% of mitochondrial proteins in plant are encoded in the nucleus and translated in the cytosol  Proteins are generally equipped with targeting signals ( a signal sequence of 12-70 amino acids at the amino terminal)  Protein import occurs at translocation site  In most cases, protein ...
3.the nature of proteins
3.the nature of proteins

...  The building blocks of proteins are monomers called amino acids  Every amino acid possesses an amino end and a carboxylic acid end  There are twenty different naturally occurring amino acids  Amino acids differ by virtue of the nature of their R groups  Amino acids bond together forming peptid ...
Ch 4. Movement of Molecules across Cell Membrane
Ch 4. Movement of Molecules across Cell Membrane

... • when a solution containing solute is separated from pure water by a semipermeable membrane (only permeable to water) water), the pressure that must be applied to solution to prevent the net flow of water into it is termed the osmotic pressure • the lower the water concentration, the higher the ...
Membrane-enclosed Crystals in Dictyostelium discoideum Cells
Membrane-enclosed Crystals in Dictyostelium discoideum Cells

... 1961; Maeda and Takeuchi, 1969), suggesting that the proteins constituting these crystals are encoded by developmentally regulated, early expressed genes. The crystals remain present throughout the stages after aggregation. They are even found in the mature spores and disappear only after their germ ...
Functions of Ribosome-Associated Chaperones and their Interaction
Functions of Ribosome-Associated Chaperones and their Interaction

... nascent polypeptides are bound by TF, only those ribosomes with bound TF were isolated and the mRNA was analyzed. TF was fused with an affinity purification tag, ribosomes were isolated, TF binding to the nascent polypeptides was stabilized by cross-linking, and thus specifically the ribosome-nascen ...
Large Scale Protein Association Prediction
Large Scale Protein Association Prediction

... /inference="non-experimental evidence, no additional details recorded" /codon_start=1 /transl_table=11 /product="DNA polymerase III, beta subunit" /protein_id="AAU20226.1" /db_xref="GI:51978676" /translation="MRFTIQKDYLVRSVQDVMKAVSSRTTIPILTGIKVVATEEGVTL TGSDADISIESFIPVEEDGKEIVEVKQSGSIVLQAKYFSEIVKKLP ...
Signal transduction networks and the biology of plant cells*
Signal transduction networks and the biology of plant cells*

... 3. A gene that encodes a subunit of cellu­ lose synthase has at last been identified. Cellulose is a linear polymer made of 6-1,4 linked glucose units. In the primary cell wall the degree of polymerization reaches over 2,000. Fifty to 80 of these linear poly­ mers lie in parallel and bind tightly to ...
Proteins
Proteins

... concentrations of inorganic electrolytes and nonprotein organic compounds do not vary appreciably from sample to sample,  and that differences in the refractive index reflect primarily differences in protein concentration. ...
7.06 Problem Set #5, Spring 2005
7.06 Problem Set #5, Spring 2005

... called COR proteins that you have been studying. Wheat, which grows under widely different climates, expresses a particular COR protein (WheCOR) that is not expressed in orange trees. The WheCor gene is nuclear-encoded, and the WheCOR protein is targeted to the chloroplast stroma. You hypothesize th ...
Amino Acids
Amino Acids

... sulfate – a detergent ...
Heavy Metals and Metalloids As a Cause for Protein Misfolding and
Heavy Metals and Metalloids As a Cause for Protein Misfolding and

... synthesized domain thus acquires 3D structural elements (α-helices, β-sheets and, in part, a tertiary structure in a highly motile molten globule state) while the rest of the polypeptide chain is still being synthesized on the ribosome [38,39]. Experiments on in vitro refolding are usually performed ...
Chapters 9 and 10 Lipids and Membranes Lipids
Chapters 9 and 10 Lipids and Membranes Lipids

... → Can transport inorganic ions, uncharged and charged organics →These show specificity for substance transported →They can be regulated by competitive and noncompetitive inhibitors →Slower rate than channels →These are very similar to enzymes in that they show saturation kinetics, substrate specific ...
Photosynthesis is the portal through which the energy of sunlight
Photosynthesis is the portal through which the energy of sunlight

... identified domains that are highly variable in amino acid composition. Since we can assume that these diverse psbS proteins are capable of causing quenching in their native species, the variable domains could include changes that were adaptive during the process of speciation. Unfortunately, testing ...
Genes affecting starch biosynthesis exert pleiotropic effects on the
Genes affecting starch biosynthesis exert pleiotropic effects on the

... unusual in that it had high total protein and low legumin contents, but a low level of `insoluble' protein and a higher total globulin content than predicted; the globulin content of the other mutants was generally as predicted from the results obtained using the analytical ultracentrifuge. No major ...
PowerPoint 簡報
PowerPoint 簡報

... Hypersensitive response (HR) The production of reactive oxygen species in disease resistance response, a process known as oxidative burst, was first observed in potato discs inoculated with a race of P. infestans that results in an HR. ...
Digestion & absorption of carbs & proteins
Digestion & absorption of carbs & proteins

... serine (section 4) trypsin, chymotrypsin, elastase, thrombin, plasmin zinc ...
Amino acid transport systems of lysosomes
Amino acid transport systems of lysosomes

... organelles, including for example the hepatic mitochondrion and epithelial brush borders, have shown apparently different sets of such systems. We proceeded to characterize a system by which basic amino acids can be exchanged, one molecule for another, possibly a different but analogous one, across ...
Bordoli Discussion Questions
Bordoli Discussion Questions

... the transcription factor Gal4 activate transcription of a Gal4-dependent promoter? 6) What additional information does Part B give you that you didn’t get in Part A? Fig. 5 1) What is E1A and why was it used in this figure? 2) What is being illustrated in the diagram? 3) Why were dl1107 and dl 1101 ...
wrzaczek_ptms
wrzaczek_ptms

... Viikki Plant Science Centre (ViPS) University of Helsinki, Finland Helsinki, August 18th, 2016 ...
Protein nutritional value of rocket leaves and
Protein nutritional value of rocket leaves and

... 1998; Nurzyńska-Wierdak, 2006, 2009), whereas the sulfate form promotes dry matter accumulation, which is confirmed by the results of the present study. The increased nitrogen rates resulted in a significant decrease in protein content as opposed to the increased potassium rates. An opposite relatio ...
Molecular Structures Shared by Prokaryotes
Molecular Structures Shared by Prokaryotes

... Prokaryotic proteins differ from eukaryotic ones One of the major problems that the PET theory has is that the organization and characteristics of prokaryotic and eukaryotic genes are quite different. One would expect that during PET the gene content would gradually undergo a steady turnover (Staley ...
The fission yeast Schizosaccharomyces pombe has two distinct
The fission yeast Schizosaccharomyces pombe has two distinct

... Indeed, Drosophila tRNase ZL , also called JHI-1 (juvenile hormone-inducible protein 1), participates in both nuclear and mitochondrial pre-tRNA 3 -end processing [16]. Both ScTrz1p (S. cerevisiae tRNase ZL ) [17,18] and ELAC2 [19,20] are localized to the nucleus and mitochondria. However, their ro ...
Signaling Through Scaffold, Anchoring, and Adaptor Proteins
Signaling Through Scaffold, Anchoring, and Adaptor Proteins

< 1 ... 190 191 192 193 194 195 196 197 198 ... 399 >

Magnesium transporter

This page links directly from the magnesium in biological systems page.Magnesium transporters are proteins that transport magnesium across the cell membrane. All forms of life require magnesium, yet the molecular mechanisms of Mg2+ uptake from the environment and the distribution of this vital element within the organism are only slowly being elucidated.In bacteria, Mg2+ is probably mainly supplied by the CorA protein and, where the CorA protein is absent, by the MgtE protein. In yeast the initial uptake is via the Alr1p and Alr2p proteins, but at this stage the only internal Mg2+ distributing protein identified is Mrs2p. Within the protozoa only one Mg2+ transporter (XntAp) has been identified. In metazoa, Mrs2p and MgtE homologues have been identified, along with two novel Mg2+ transport systems TRPM6/TRPM7 and PCLN-1. Finally, in plants, a family of Mrs2p homologues has been identified along with another novel protein, AtMHX.
  • studyres.com © 2026
  • DMCA
  • Privacy
  • Terms
  • Report