• Study Resource
  • Explore Categories
    • Arts & Humanities
    • Business
    • Engineering & Technology
    • Foreign Language
    • History
    • Math
    • Science
    • Social Science

    Top subcategories

    • Advanced Math
    • Algebra
    • Basic Math
    • Calculus
    • Geometry
    • Linear Algebra
    • Pre-Algebra
    • Pre-Calculus
    • Statistics And Probability
    • Trigonometry
    • other →

    Top subcategories

    • Astronomy
    • Astrophysics
    • Biology
    • Chemistry
    • Earth Science
    • Environmental Science
    • Health Science
    • Physics
    • other →

    Top subcategories

    • Anthropology
    • Law
    • Political Science
    • Psychology
    • Sociology
    • other →

    Top subcategories

    • Accounting
    • Economics
    • Finance
    • Management
    • other →

    Top subcategories

    • Aerospace Engineering
    • Bioengineering
    • Chemical Engineering
    • Civil Engineering
    • Computer Science
    • Electrical Engineering
    • Industrial Engineering
    • Mechanical Engineering
    • Web Design
    • other →

    Top subcategories

    • Architecture
    • Communications
    • English
    • Gender Studies
    • Music
    • Performing Arts
    • Philosophy
    • Religious Studies
    • Writing
    • other →

    Top subcategories

    • Ancient History
    • European History
    • US History
    • World History
    • other →

    Top subcategories

    • Croatian
    • Czech
    • Finnish
    • Greek
    • Hindi
    • Japanese
    • Korean
    • Persian
    • Swedish
    • Turkish
    • other →
 
Profile Documents Logout
Upload
Nucleotide Metabolism - Indiana University
Nucleotide Metabolism - Indiana University

... • Purine biosynthesis – Salvage is a major pathway – Base synthesized while attached to ribose – IMP is common intermediate for AMP and GMP, but itself is not a typical nucleotide ...
MIAPE_Quant_v1.0_Template
MIAPE_Quant_v1.0_Template

... Replicates: experiment to be reproduced or repeated in order to test the variability of observed values. Technical replicates: Replicates that share the same sample; i.e. the measurements are repeated. The technical variability is tested. Biological replicates: Replicate where different samples are ...
Chapter 10
Chapter 10

... translated into amino acid sequences • The flow of information from gene to protein is based on a triplet code. • The genetic instructions for the amino acid sequence of a polypeptide chain are written in DNA and RNA as a series of nonoverlapping three-base “words” called ...
Figure 5.15 The 20 amino acids of proteins
Figure 5.15 The 20 amino acids of proteins

... • Water is more dense than ice. At 4°C water is at its most dense state, then as it cools to O°C, the molecules freeze. The H bonds keep the water molecules slightly apart (like a lattice) so air pockets form ...
Chem*3560 Lecture 16: Reciprocal regulation of glycolysis and
Chem*3560 Lecture 16: Reciprocal regulation of glycolysis and

... Glucose produced by the liver is quickly secreted, and this breaks the circuit that might give rise to a futile cycle. ...
plantcell.org - Schnable Lab
plantcell.org - Schnable Lab

www.iplantcollaborative.org
www.iplantcollaborative.org

... D. Hedgecock et al. (2007) Transcriptomic analysis of growth heterosis in larval Pacific oysters (Crassostrea gigas) PNAS 104; p2313-2318 ...
unit 3 – photosynthesis and cellular respiration
unit 3 – photosynthesis and cellular respiration

... enzymes to intermediates of glycolysis and the citric acid cycle. Before amino acids can enter these processes, deamination must take place – the amino groups must be removed. The nitrogen containing wastes are excreted in the form of ammonia, urea or uric acid.  Fats are also digested and absorbed ...
File
File

... alternating double bonds and single bonds between carbon atoms 3. Amino acids: are molecules containing an amine group, a carboxylic acid group and a side chain (specific) ...
Classification and domain analysis of protein
Classification and domain analysis of protein

... BCR, BRD, FAST, G11, PDHK, PIKK, RIO, TAF1 and TIF1, and have been analysed in this study. Figure 1 displays the kinase group representation of hominids, which includes both ePKs and aPKs. Table 2 shows the distribution of ePKs (serine/threonine (Ser/Thr) and tyrosine kinases (Tyk)) in various group ...
Fibrous proteins and collagen
Fibrous proteins and collagen

... 6. Formation of collagen fibrils: Individual tropocollagen molecules spontaneously associate to form collagen fibrils. They form an ordered, overlapping, parallel array, with adjacent collagen molecules arranged in a staggered pattern, each overlapping its neighbor by a length approximately three-q ...
Abstract Here we describe our unprecedented approach in
Abstract Here we describe our unprecedented approach in

... PAR down-regulated the gene expression levels of the following members of the matrix metalloproteinase (MMP) family, which are involved in the breakdown of the extracellular matrix and tissue remodeling in normal physiological processes and disease progression: Mmp3, Mmp10, Mmp13, Mmp 19 and tissue ...
Planta - University of Regina
Planta - University of Regina

The activity reaction core and plasticity of metabolic networks
The activity reaction core and plasticity of metabolic networks

... tetrahydrofolte biosynthesis.  Both pathways are present in H. pylori and E. coli. ...
Mechanistic Role of an NS4A Peptide Cofactor with the Truncated
Mechanistic Role of an NS4A Peptide Cofactor with the Truncated

... the intermolecular consensus sequence site2 D/E-X-X-X-XC*-A/S differs from the intramolecular cleavage site by substitution of Thr for Cys at the P1 position (Grakoui et al., 1993a; Pizzi et al., 1994). A body of experimental evidence demonstrated that the 70 kDa NS3 protein is composed of two domai ...
amino acid mixture
amino acid mixture

... acids when presented in the free form), or by glycylglycine, which has been shown to inhibit absorption of several di- and tri-peptides in vitro (Rubino et al., 1971; Addison et al., 1974; Das & Radhakrishnan, 1975), might be explained if these amino acid residues were absorbed by an alternative pep ...
документ
документ

... Phe biosynthesis in bacterial cell are quite uncommon, though today it is known a large number of RuMP cycle auxotrophic mutants of methylotrophs, covering numerious steps in aromatic amino acid biosynthesis (Dijkhuizen, 1996). The selection of new producers of Phe has a big importance for studies o ...
Validation of an HPLC method for the determination of
Validation of an HPLC method for the determination of

... determination of amino acids.4–26 Mostly, the methods were based on the technology developed by Moore and Stein,4 which includes post-column derivatisation and detection in the visible region on an amino acid analyser. These analyses are reliable, but costly and time-consuming.9 The HPLC technique, ...
CaoSpr10
CaoSpr10

... the presence of 10 M tRNA and 1 mM proline and C) the overall editing in the presence 10 M tRNA and 5 mM alaline by wild-type E. coli ProRS and two mutants (H302A and E303A), with the wild-type ProRS activity set at 100%. The enzyme concentrations used were 1 M (BioRad concentration). Values repo ...
Characterization and Cloning of the Chlorophyll
Characterization and Cloning of the Chlorophyll

... Analyses of the N-terminal sequences were performed with the three peptides separated by SDSPAGE after heat treatment of the purified PPD type 2 (Fig. 4). The amino acid sequences of three peptides were determined: 16.8 kD, EEDIWEYIYGEGADKPPTGVLMKEEFFRRY; 15.9 kD, EDIWEYIYGEGADKPPTGVLMKEEFFRHYY; and ...
A Journey from the Pool of Chiral Synthetic Building Blocks to Cell
A Journey from the Pool of Chiral Synthetic Building Blocks to Cell

... C-terminal, fully active neurotensin segment NTS(8-13). The neurotensin GPC receptor family NT1-3 is present in the brain and in the digestive system, and NTS modulates numerous processes related to dopamine neurotransmission, analgesia, inhibition of food intake, growth of cancer cells etc.[26] For ...
Chapter 3
Chapter 3

Jeopardy Biochem Jeopardy October 02, 2012
Jeopardy Biochem Jeopardy October 02, 2012

... Biochem Jeopardy ...
Document
Document

... temperature, and time. Distinguish measured or exact numbers and determine the number of significant figures in a measured number. Adjust calculated answers to give the correct number of significant figures. Use the numerical values of metric prefixes. Write and use conversion factors. Calculate the ...
pH stability of HLA-DR4 complexes with antigenic peptides .
pH stability of HLA-DR4 complexes with antigenic peptides .

... ABSTRACT: Complexes between antigenic peptides and class II proteins of the major histocompatibility complex (MHC) trigger cellular immune responses. These complexes usually dissociate more rapidly at mildly acidic pH, where they are formed intracellularly, as compared to neutral pH, where they func ...
< 1 ... 138 139 140 141 142 143 144 145 146 ... 693 >

Proteolysis



Proteolysis is the breakdown of proteins into smaller polypeptides or amino acids. Uncatalysed, the hydrolysis of peptide bonds is extremely slow, taking hundreds of years. Proteolysis is typically catalysed by cellular enzymes called proteases, but may also occur by intra-molecular digestion. Low pH or high temperatures can also cause proteolysis non-enzymatically.Proteolysis in organisms serves many purposes; for example, digestive enzymes break down proteins in food to provide amino acids for the organism, while proteolytic processing of a polypeptide chain after its synthesis may be necessary for the production of an active protein. It is also important in the regulation of some physiological and cellular processes, as well as preventing the accumulation of unwanted or abnormal proteins in cells. Consequently, dis-regulation of proteolysis can cause diseases, and is used in some venoms to damage their prey.Proteolysis is important as an analytical tool for studying proteins in the laboratory, as well as industrially, for example in food processing and stain removal.
  • studyres.com © 2025
  • DMCA
  • Privacy
  • Terms
  • Report