• Study Resource
  • Explore Categories
    • Arts & Humanities
    • Business
    • Engineering & Technology
    • Foreign Language
    • History
    • Math
    • Science
    • Social Science

    Top subcategories

    • Advanced Math
    • Algebra
    • Basic Math
    • Calculus
    • Geometry
    • Linear Algebra
    • Pre-Algebra
    • Pre-Calculus
    • Statistics And Probability
    • Trigonometry
    • other →

    Top subcategories

    • Astronomy
    • Astrophysics
    • Biology
    • Chemistry
    • Earth Science
    • Environmental Science
    • Health Science
    • Physics
    • other →

    Top subcategories

    • Anthropology
    • Law
    • Political Science
    • Psychology
    • Sociology
    • other →

    Top subcategories

    • Accounting
    • Economics
    • Finance
    • Management
    • other →

    Top subcategories

    • Aerospace Engineering
    • Bioengineering
    • Chemical Engineering
    • Civil Engineering
    • Computer Science
    • Electrical Engineering
    • Industrial Engineering
    • Mechanical Engineering
    • Web Design
    • other →

    Top subcategories

    • Architecture
    • Communications
    • English
    • Gender Studies
    • Music
    • Performing Arts
    • Philosophy
    • Religious Studies
    • Writing
    • other →

    Top subcategories

    • Ancient History
    • European History
    • US History
    • World History
    • other →

    Top subcategories

    • Croatian
    • Czech
    • Finnish
    • Greek
    • Hindi
    • Japanese
    • Korean
    • Persian
    • Swedish
    • Turkish
    • other →
 
Profile Documents Logout
Upload
Role of thioredoxin reductase in the Yap1p-dependent response to oxidative stress in Saccharomyces cerevisiae .
Role of thioredoxin reductase in the Yap1p-dependent response to oxidative stress in Saccharomyces cerevisiae .

... presence of 50 mM and 75 mM 3-AT in the absence of H2O2 (Fig. 1), were chosen for further study. To determine whether the ability of YRS94#4 and YRS94#11 to grow on the SC±His medium in the presence of 75 mM 3-AT resulted from a cis-acting mutation at the TRX2 promoter fused to the HIS3 gene or from ...
Prevalence of ESBL and MBL antibiotic resistance genes in
Prevalence of ESBL and MBL antibiotic resistance genes in

... • Aranzazu Valverde, Teresa MC, Lucia GM, Fernando B and Rafael C (2008) Complex molecular epidemiology of extended-spectrum β-lactamases in Klebsiella pneumoniae: a long-term perspective from a single intitution in Madrid. Journal of antimicrobial Chemotherepy 61:64-72 • Franceco L, Jean-Denis D, C ...
harvey lodish . david baltimore arnold berk s
harvey lodish . david baltimore arnold berk s

... 1 The Dynamic Cell 2 Chemical Foundations 3 Protein Structure and Function 4 Nucleic Acids, the Genetic Code, and Protein Synthesis 5 Cell Organization, Subcellular Structure, and Cell Division 6 Manipulating Cells and Viruses in ...
Unit 1 - Calderglen High School
Unit 1 - Calderglen High School

... expressed). Tissue stem cells Tissue stem cells replenish differentiated cells that need to be replaced. Unlike embryonic stem cells, they can only produce a limited range of cell types. For example, the stem cells in our bone marrow will only give rise to different types of blood cells e.g. red blo ...
07 NucleicAcids-06b
07 NucleicAcids-06b

... DNA sample centrifuged after 40 min (after second replication) ...
Translation
Translation

... b. bacterial ribosomes are typically 70s when the two components are combined; the small subunit is 30 s and the large 50 s when measured apart. c. ribosomes in eukaryotic cytoplasm are slightly larger; 80s overall with 35s and 60 s subunits d. each component has a long piece of RNA (rRNA) that serv ...
Presentación de PowerPoint
Presentación de PowerPoint

... Some examples of self-organization which may be relevant to the origin of life ...
Arabidopsis thaliana as a model species for studying plant biology
Arabidopsis thaliana as a model species for studying plant biology

Comparing DNA
Comparing DNA

... 2. Count the number of base pairs (bp) in each piece of DNA that you created for each DNA sample. Record the base pair number above each DNA fragment. 3. Place the fragments on the simulated gel by making a dark rectangular mark beside the appropriate bp number in the correct lane for each sample. 4 ...
Transcription factor AP-2 is tissue-specific in
Transcription factor AP-2 is tissue-specific in

... factors controlling tissue-specific expression and repression of XK81A1 could, thus, lead to the identification of autonomous ectodermal determinants and a greater understanding of the molecular mechanisms of embryonic induction. In earlier studies, we showed that 487 base pairs (bp) of 5' flanking ...
protein-complex_cros..
protein-complex_cros..

BIOCHEMISTRY Nucleic Acids
BIOCHEMISTRY Nucleic Acids

... DNA Replication • The bases of the separated strands are not connected by hydrogen bonds anymore – they can now pair with free individual nucleotides present in the nucleus (C≡G & A=T) one at a time & form new hydrogen bonds with the old strand (= the template). • The enzyme DNA-polymerase checks i ...
D - mbg
D - mbg

... DETERMINE  THE  RELATEDNESS  OF  EIGHT  VERTEBRATE  SPECIES  BASED   ON  DIFFERENCES  IN  THE  BETA  CHAIN  OF  THEIR  HEMOGLOBIN   >Homo   VHLTPEKSAVTAGNVDEVGEGLVTQFESDLSTPDAVMGPK   >Rhesus   VHLTPEKNAVTTGNVDEVGEGLLTQFESDLSSPDAVMGPK   >Mouse   VHLTDAKAAV ...
PROTEINS
PROTEINS

... membrane. Other macromolecular assemblies act as molecular machines, carrying out the most complex cellular processes by integrating individual functions into one coordinated process. For example, the transcriptional machine that initiates the synthesis of messenger RNA (mRNA) consists of RNA polyme ...
Proteins – Essential Biomolecules
Proteins – Essential Biomolecules

... acids, nucleotides the building are the major functions of proteins? The gene is atfatty a particular position are or locus on theblocks DNA, one What of its two of the larger biomolecules. Proteins play important structural and metabolic roles in the human body. strands. An enzyme unzips the DNA at ...
Activation of Metallothionein Gene Expression
Activation of Metallothionein Gene Expression

... cellular proliferation and apoptosis (6 –9), perhaps through an interaction of MT with nuclear factor-kB-DNA complexes (10). These properties of MTs reflect their potential importance for malignant progression; high expression of MTs correlates with poor prognosis and progressive disease in a number ...
A1991GH39300001
A1991GH39300001

... reieardl direction of the lab was to study imiTwno. RNA preparations extracted from niyelwna cells, globulin biosynthesis usmg molecular biology ~which, ksc*Dy, I had not discarded.This opened up proaches. One of the first steps In this endeavor was many studies on immunogiobin mRNA,, wisids were to ...
From Gene to Protein
From Gene to Protein

... • Proteins destined for the endomembrane system or for secretion – Must be transported into the ER ...
Characterization of the Plasmid-Encoded Arsenic Salts Resistance
Characterization of the Plasmid-Encoded Arsenic Salts Resistance

... repressor protein, the down-regulation produced by the ArsD is inducer-independent, and its expression has little effect on the level of resistance set by the ArsR [27]. ArsA and ArsB are necessary and sufficient for an ATP-coupled oxyanion pump, which catalyzes extrusion of arsenite and antimonite, ...
A Comparative Genomic Method for Computational
A Comparative Genomic Method for Computational

... Sets of 3+ DnaA-regulated, orthologous transcription units containing at least 1 cross-species pair of binding sites displaying conservation of sequence (2+ identical DnaA boxes) or location (within 20 base pairs) (127/88) ...
Identification of Novel Starch Traits in Sorghum
Identification of Novel Starch Traits in Sorghum

... introns, some mutations were also found in exons in all genes studied. These SNP changes resulted in some differences in the amino acids in each of the starch synthesis genes of interest and which leads to alternative proteins encoded and may subsequently result in an altered starch phenotype in our ...
Lesson 1 Introduction to virulence factors
Lesson 1 Introduction to virulence factors

Reverse transcription-pcr (rt-pcr)
Reverse transcription-pcr (rt-pcr)

... The reaction tube of RT-PCR contains the following: Reverse transcriptase: the enzyme catalyses the reverse transcription reaction. There are several commercially available enzymes usually isolated from retroviruses. Buffer.! dNTPs (like those used in PCR), and they will be incorporated into the ...
SPRGM Teacher Notes - 3D Molecular Designs
SPRGM Teacher Notes - 3D Molecular Designs

... Dimension 3. Disciplinary Core Ideas ...
Key Area 2 – Pupil Booklet
Key Area 2 – Pupil Booklet

... the four bases A,T C and G 7. give the opposite bases in a genetic code with the letters A,T C and G 8. explain that by testing a DNA sample, this information can be used to identify a person’s father, or can be used to link people to a crime scene. 10. state that testing for a particular gene can i ...
< 1 ... 188 189 190 191 192 193 194 195 196 ... 509 >

Silencer (genetics)

  • studyres.com © 2026
  • DMCA
  • Privacy
  • Terms
  • Report