• Study Resource
  • Explore Categories
    • Arts & Humanities
    • Business
    • Engineering & Technology
    • Foreign Language
    • History
    • Math
    • Science
    • Social Science

    Top subcategories

    • Advanced Math
    • Algebra
    • Basic Math
    • Calculus
    • Geometry
    • Linear Algebra
    • Pre-Algebra
    • Pre-Calculus
    • Statistics And Probability
    • Trigonometry
    • other →

    Top subcategories

    • Astronomy
    • Astrophysics
    • Biology
    • Chemistry
    • Earth Science
    • Environmental Science
    • Health Science
    • Physics
    • other →

    Top subcategories

    • Anthropology
    • Law
    • Political Science
    • Psychology
    • Sociology
    • other →

    Top subcategories

    • Accounting
    • Economics
    • Finance
    • Management
    • other →

    Top subcategories

    • Aerospace Engineering
    • Bioengineering
    • Chemical Engineering
    • Civil Engineering
    • Computer Science
    • Electrical Engineering
    • Industrial Engineering
    • Mechanical Engineering
    • Web Design
    • other →

    Top subcategories

    • Architecture
    • Communications
    • English
    • Gender Studies
    • Music
    • Performing Arts
    • Philosophy
    • Religious Studies
    • Writing
    • other →

    Top subcategories

    • Ancient History
    • European History
    • US History
    • World History
    • other →

    Top subcategories

    • Croatian
    • Czech
    • Finnish
    • Greek
    • Hindi
    • Japanese
    • Korean
    • Persian
    • Swedish
    • Turkish
    • other →
 
Profile Documents Logout
Upload
Gene Section PTCH (patched homolog) Atlas of Genetics and Cytogenetics
Gene Section PTCH (patched homolog) Atlas of Genetics and Cytogenetics

... Description 23 exons, 2 of which are non-coding; 34 kb. ...
Describe the potential causes for,and appropriate clinical chemistry
Describe the potential causes for,and appropriate clinical chemistry

... diseases such as DM, hypothyroidism and hypopituitarism may cause FTT but they are more common later during childhood. Clinical chemistry investigations: Non organic causes of FTT are more common than organic causes especially in developing countries. Nevertheless, it is considered appropriate to sc ...
Plant Development presentation
Plant Development presentation

... Genes expressed during early Capitulum Development specify floret identity ...
Print as PDF
Print as PDF

... gene sets of interest, including associated genes, homologs, and references to external links. Gene Intersection Lists are useful for determining which information is shared between gene sets of interest. In addition, GeneWeaver tools allow users to Combine gene sets of interest or perform more comp ...
Genetics 3.4- Inheritance
Genetics 3.4- Inheritance

... product of the probability of the events occurring separately. 2. Chance of inheriting a specific allele from one parent and a specific allele from another is 1/2 x 1/2 or 1/4. 3. Possible combinations for the alleles Hh x Hh are the following: ...
Activity Overview
Activity Overview

... The traits you have are determined by the genes in the chromosomes you inherit from your parents. A gene is a specific place on a chromosome that is responsible for a trait (characteristic). Every trait is controlled by at least one gene from Mom and at least one gene from Dad, thus it takes at leas ...
МІНІСТЕРСТВО ОХОРОНИ ЗДОРОВ`Я УКРАЇНИ
МІНІСТЕРСТВО ОХОРОНИ ЗДОРОВ`Я УКРАЇНИ

... Progression of clinical picture, chronic protracted course of the disease with relapses are characteristic for monogenic pathology. For example in neurofibromatosis type 1 child are born with pigmented spots of color of coffee with milk. With age spots increase in size and number, appear in the groi ...
Leukaemia Section t(2;11)(q31;p15) NUP98/HOXD13 t(2;11)(q31;p15) NUP98/HOXD11 Atlas of Genetics and Cytogenetics
Leukaemia Section t(2;11)(q31;p15) NUP98/HOXD13 t(2;11)(q31;p15) NUP98/HOXD11 Atlas of Genetics and Cytogenetics

... 98-KD protein a component of nuclear pore complex (NPC). NUP98 is found in the nucleoplasmic and cytoplasmic domains of the NPC, and functions as a transport co-factor of RNA and protein between the nucleus and cytoplasm. In addition, NUP98 appear to be involved in mitotic spindle formation and in c ...
Biblical and Talmudic Human Genetics
Biblical and Talmudic Human Genetics

... into testes, resulting in a male child. SRY, activated on about day 40 of fetal development, may explain the gemora in Berachos (60a), which stated that 3 days after intimacy, the husband should pray that his sperm remains viable and from day 3 to day 40, he should pray that the fetus is a healthy m ...
Otosclerosis - St. Luke`s Hospital
Otosclerosis - St. Luke`s Hospital

... number of patients may not obtain ideal results. The risks of this operation are the same as any other operation of the ear. ...
Quality control gone wrong: mitochondria, lysosomal storage
Quality control gone wrong: mitochondria, lysosomal storage

... in cellular and mitochondrial quality control (Rubinsztein, 2006; Martinez-Vicente and Cuervo, 2007; Pan et al., 2008). Dysfunctional mitochondria can be harmful to the cell as complex I (CI; and to a lesser extent CIII) of the respiratory chain generate damaging reactive oxygen species (ROS; Chance ...
Editorial Comment Will Gene Markers Predict Hypertension?
Editorial Comment Will Gene Markers Predict Hypertension?

... association has not been established, it suggests that the specific B27 antigen may be related to the pathogenic mechanism leading to the disease. In other words, the marker gene does not just sit next to the disease gene, it actually is a gene involved in the pathogenic process leading to the disea ...
the Note
the Note

...  prenatal diagnosis - to detect disorders in unborn babies if the mother is concerned about alcohol or drug abuse during pregnancy, injury, family history or age. Counselling about the quality of life of the child should the parents choose to have the baby or whether they choose to terminate the pr ...
ps_and_pedigree_probs
ps_and_pedigree_probs

... In fruit flies (Drosophila), the gene for red eye color, R, is dominant to the gene for white eye color, r. The trait is sex-linked. A red-eyed male was bred to a heterozygous red-eyed female. Mark true/false. a. The genes for eye color are carried on the X chromosome. b. The male's genotype is XRYr ...
Document
Document

... E2. The plasmid with the wrong orientation would not work because the coding sequence would be in the wrong direction relative to the promoter sequence. Therefore, the region containing the somatostatin sequence would not be transcribed into RNA. E3. One possibility is to clone the toxin-producing g ...
Report Template for Positive Diagnosis Result
Report Template for Positive Diagnosis Result

... The single nucleotide substitution described above results in the substitution of a valine for an isoleucine at amino acid position 525 of the SMAD4 (SMAD family member 4) protein. This individual is heterozygous for the p.Ile525Val variant in the SMAD4 gene. To our knowledge, this sequence variant ...
Genetic Mutations
Genetic Mutations

... frame” of the genetic message. – May change every amino acid that follows the point of the mutation. – Can alter a protein so much that it is unable to perform its normal function. ...
Advancements in Genetic Engineering
Advancements in Genetic Engineering

... pretty to form a family, the genetic components in their descendants are limited to sets of combinations. Every aspect of physiologic functions have at most three combinations, once the both parties of couple is determined, whether their kids are healthy or not at a certain aspect is almost unchange ...
Genetic Testing - Alzheimer`s Association
Genetic Testing - Alzheimer`s Association

... mutations, or variant forms, of genes associated with the disease. Three of those genes ― located on chromosomes 21, 14, and 1 ― are linked to the early-onset forms of Alzheimer’s in which symptoms usually begin to appear between a person’s early 40s and mid-50s. If someone has one of these gene mut ...
Variations to Mendelian Genetics
Variations to Mendelian Genetics

... AaBbCcDd medium skin tone (4 dominant/4 recessive) ...
The Price of Silent Mutations
The Price of Silent Mutations

... Francisco Baralle of the International Center the silent mutation caused a pause during transfor Genetic Engineering and Biotechnology in lation, which in turn allowed the protein time Trieste, Italy. The investigators found that 25 t o adopt an unusual structure. If this pause ocpercent of the sile ...
Genetics and Genomics in Medicine Chapter 5 Questions Multiple
Genetics and Genomics in Medicine Chapter 5 Questions Multiple

... content. Comment on the degree of DNA sequence sharing between these two chromosomes, and the consequences of having very different sex chromosomes in males. ...
PPT - wFleaBase
PPT - wFleaBase

... length. Insufficient. (FL_alt_splice_flag; 0) Stitched EST lacks compatibility with preexisting protein annotations; invalid and no alt-splice template available. Applied to Dappu1_FM5_196379,0 >asmbl_7600-based protein MSFIILLCLVAFASAAPQRAAVRVLQLDPVCLLPPVADPTQNCNNFSI… ...
nonmend
nonmend

... Rule Three: For sex linkage, show alleles on X’s (e.g. XR) - none on Y’s. Prediction must include gender. Use Mendelian letters for genes - not Morgan’s (+/-) naming system. ...
ppt
ppt

... Mutations in Reproductive (Sex) Cells VS. Body cells -Mutations in sex cells a.k.a. gametes (sperm and egg cells) can be passed down to a person’s children, but might not affect the parent -Mutations in body cells cannot be passed on to your children, however, they can cause cancer or other problem ...
< 1 ... 197 198 199 200 201 202 203 204 205 ... 342 >

Neuronal ceroid lipofuscinosis

Neuronal ceroid lipofuscinoses (NCL) is the general name for a family of at least eight genetically separate neurodegenerative disorders that result from excessive accumulation of lipopigments (lipofuscin) in the body's tissues. These lipopigments are made up of fats and proteins. Their name comes from the word stem lipo-, which is a variation on ""lipid"" or ""fat"", and from the term pigment, used because the substances take on a greenish-yellow color when viewed under an ultraviolet light microscope. These lipofuscin materials build up in neuronal cells and many organs, including the liver, spleen, myocardium, and kidneys.
  • studyres.com © 2026
  • DMCA
  • Privacy
  • Terms
  • Report