• Study Resource
  • Explore Categories
    • Arts & Humanities
    • Business
    • Engineering & Technology
    • Foreign Language
    • History
    • Math
    • Science
    • Social Science

    Top subcategories

    • Advanced Math
    • Algebra
    • Basic Math
    • Calculus
    • Geometry
    • Linear Algebra
    • Pre-Algebra
    • Pre-Calculus
    • Statistics And Probability
    • Trigonometry
    • other →

    Top subcategories

    • Astronomy
    • Astrophysics
    • Biology
    • Chemistry
    • Earth Science
    • Environmental Science
    • Health Science
    • Physics
    • other →

    Top subcategories

    • Anthropology
    • Law
    • Political Science
    • Psychology
    • Sociology
    • other →

    Top subcategories

    • Accounting
    • Economics
    • Finance
    • Management
    • other →

    Top subcategories

    • Aerospace Engineering
    • Bioengineering
    • Chemical Engineering
    • Civil Engineering
    • Computer Science
    • Electrical Engineering
    • Industrial Engineering
    • Mechanical Engineering
    • Web Design
    • other →

    Top subcategories

    • Architecture
    • Communications
    • English
    • Gender Studies
    • Music
    • Performing Arts
    • Philosophy
    • Religious Studies
    • Writing
    • other →

    Top subcategories

    • Ancient History
    • European History
    • US History
    • World History
    • other →

    Top subcategories

    • Croatian
    • Czech
    • Finnish
    • Greek
    • Hindi
    • Japanese
    • Korean
    • Persian
    • Swedish
    • Turkish
    • other →
 
Profile Documents Logout
Upload
Identification of two novel mutations associated
Identification of two novel mutations associated

... National Center for Biotechnology Information (NCBI). Assignment of nucleotide numbering was according to NCBI accession numbers NM_000312.2 for PROC and NM_000313.1 for PROS1. ...
S1. Comparison of complex functions in MCL-GO
S1. Comparison of complex functions in MCL-GO

... are conserved in their biological processes in E. coli than yeast. Conversely fewer superfamilies are conserved in molecular function and cellular component in E. coli than yeast. Notice that the numbers are correlated with organismal complexity. The results suggest that more complex organisms have ...
Organisms are relatively similar at a molecular level
Organisms are relatively similar at a molecular level

... and homology. If the sequences in two species show similarity because they code for proteins (or regions of proteins) with similar functions, analogy would be the explanation. If the sequences show similarity because the two species share common ancestry, then the similarity is due to homology. Let' ...
Unit 2 Biomolecules NGSS
Unit 2 Biomolecules NGSS

... As matter and energy flow through different organizational levels of living systems, chemical elements are recombined in different ways to form different products. (HS-LS1-6),(HS-LS1-7) ...
Commentaries on Cutting Edge Science
Commentaries on Cutting Edge Science

... that Thbs4 interacted with ATF6. To examine whether Thbs4mediated activation of ATF6 required Thbs4 translocation to the Golgi, they generated a form of Thbs4 with a C-terminal ER retention KDEL motif (Thbs4-KDEL), which should convert Thbs4 into an ER resident protein. Unlike native Thbs4, Thbs4-KD ...
lecture10_13
lecture10_13

... What’s Next Predicting function from structure ...
Towards the atomic level protein sequence analysis
Towards the atomic level protein sequence analysis

... Viral sequences and aquaporins from various plants and animal origin have been analyzed based on the designed algorithm and the demarcation at carbon level was found to be very prominent. Keywords: Aquaporins, carbon, dynamic programming, viral protein. ______________________________________________ ...
All Proteins Have a Basic Molecular Formula
All Proteins Have a Basic Molecular Formula

Data/hora: 30/03/2017 16:44:40 Provedor de dados: 61 País: Brazil
Data/hora: 30/03/2017 16:44:40 Provedor de dados: 61 País: Brazil

... in combination to avoid or to resist water deficit. Genotypes that differ in tolerance to water deficit may show qualitative and quantitative differences in gene expression when submitted to drought periods. Four cotton (Gossypium hirsutum L.) genotypes (Siokra L-23, Stoneville 506, CS 50 and T-1521 ...
structbio_lecture_BCH339N_2016
structbio_lecture_BCH339N_2016

... Chinchilla Ribonuclease >gi|533199034|ref|XP_005412130.1| PREDICTED: ribonuclease pancreatic [Chinchilla lanigera] MTLEKSLVLFSLLILVLLGLGWVQPSLGKESSAMKFQRQHMDSSGSPSTNANYCNEMMKGRNMTQGYCKP VNTFVHEPLADVQAVCFQKNVPCKNGQSNCYQSNSNMHITDCRLTSNSKYPNCSYRTSRENKGIIVACEG NPYVPVHFDASV ...
Chem*3560 Lecture 1: Structure and Function in Biochemistry
Chem*3560 Lecture 1: Structure and Function in Biochemistry

... van der Waals effect, side-chain H-bonds ion pairs Myoglobin structure shown is about 75% alpha helix in a chain of 153 amino acids. See Lehninger p.203. Folded pattern is held together by ...
PPT - FLI - Leibniz Institute for Age Research
PPT - FLI - Leibniz Institute for Age Research

... The first three-dimensional structure of a biopolymer was the DNA model built by J. D. Watson and F. H. C. Crick in 1953 taking into account fiber diffraction data provided by M. H. F. Wilkins and others (Nobel Prize in Physiology or Medicine, 1962). The very first single-crystal DNA structure was r ...
A PRESENTATION ON AMINO ACIDS AND PROTEINS
A PRESENTATION ON AMINO ACIDS AND PROTEINS

... of a simple proteins united covalently or non covalently with non-protein factor. ...
Human EGF / Epidermal Growth Factor Protein
Human EGF / Epidermal Growth Factor Protein

... integrity. EGF acts by binding with high affinity to epidermal growth factor receptor on the cell surface and stimulating the intrinsic protein-tyrosine kinase activity of the receptor. The tyrosine kinase activity, in turn, initiates a signal transduction cascade that results in a variety of bioche ...
UNIT 2 BIOLOGICAL CHEMISTRY ORGANIC MOLECULES
UNIT 2 BIOLOGICAL CHEMISTRY ORGANIC MOLECULES

... A.Fatty Acids These are the simplest Lipids Def: A simple lipid molecule composed of a long hydrocarbon chain w/ a carboxyl group at one end . ...
ESTIMATION OF PROTEIN BY LOWRY`S METHOD
ESTIMATION OF PROTEIN BY LOWRY`S METHOD

... Bovine Serum albumin of 100mg is weighed accurately and dissolved in 100ml of distilled water in a standard flask (concentration 1 µg /ml). 2. Working Standard: The Stock Solution of 10 ml is distilled to 100ml with distilled water in a standard flask (concentration 100 mg/ml). 3. Folin’s Phenol Rea ...
The CENTRAL DOGMA in Biology:
The CENTRAL DOGMA in Biology:

... 4. Inside the nucleus, the 2 strands of DNA rejoin and recoil. ...
Teaching Notes
Teaching Notes

... Q1. In PDB entry 1hla, how many polymer chains are there? What are they? A1: There are 3 protein chains - HLA, beta-2 microglobulin and the antigen peptide Q2. Where are the Cys residues located? Comment about how they are contributing to the stability of the structure. A2: A single S-S bond stabili ...
Anti-Phospho-Ser181 TAO2 Antibody
Anti-Phospho-Ser181 TAO2 Antibody

... Product Description: Affinity purified rabbit polyclonal antibody. Biological Significance: In vitro, TAO (thousand and one amino acid) protein kinase 2 (TAO2) activates MAP/ERK kinases (MEKs) 3, 4, and 6 toward their substrates p38 MAP kinase JNK/SAPK (Chen et al., 1999; Chen and Cobb, 2001). This ...
Slide 1
Slide 1

... proteins involved in the subsequent cascade events may dock, be allosterically modified & undergo functional alteration. SH2 & SH3, src homology domains 2 & 3, are the most common of the docking sites generated by tyrosine SH2 domains are common protein motifs that phosphorylation by tyrosine kinase ...
Moving Proteins into Membranes and Organelles Moving Proteins
Moving Proteins into Membranes and Organelles Moving Proteins

... minute and exports 6 small ribosomal subunits. The formed protein also called nucleoporin NPC are: – large - 125 million Da – complex- composed of more than 30 different proteins – gated - Have diffusion limit of ~40 kDa. Larger proteins require active transport – busy - every minute each NPC must t ...
(Submitted) Genetic Synthesis of Periodic Protein Materials M. J.
(Submitted) Genetic Synthesis of Periodic Protein Materials M. J.

... Full descriptions appear elsewhere about the parameters to be considered in designing artificial protein genes of this type, the effectiveness of different gene construction and expression strategies utilized by us thus far and, the specific properties of the various materials derived from these eff ...
SR Proteins - The Plant Cell
SR Proteins - The Plant Cell

... cussed in Manley and Krainer, 2010). In particular, the existence of many additional proteins with RS domains that do not necessarily possess an RRM domain introduced further confusion. Due to the importance of SR proteins as regulators for proper gene expression and protein diversity, the splicing ...
Trans-activation and DNA-binding properties of
Trans-activation and DNA-binding properties of

... encoding proteins which share homology in their DNA-binding domain (3—8). This DNA-binding domain is closely related to that of the nuclear proteins known as the high mobility group (HMG) proteins. The HMG-box DNA-binding domain is -80 amino acids and contains highly conserved proline, aromatic and ...
Amino Acids
Amino Acids

... and transport into the blood, so lots of them may indicate a cholesterol problem, so these complexes are called “bad cholesterol”. High-density lipoproteins tend to transport cholesterol back into the liver for storage, so tend to be called “good cholesterol”. It’s all the same cholesterol…. ...
< 1 ... 325 326 327 328 329 330 331 332 333 ... 520 >

Protein–protein interaction



Protein–protein interactions (PPIs) refer to physical contacts established between two or more proteins as a result of biochemical events and/or electrostatic forces.In fact, proteins are vital macromolecules, at both cellular and systemic levels, but they rarely act alone. Diverse essential molecular processes within a cell are carried out by molecular machines that are built from a large number of protein components organized by their PPIs. Indeed, these interactions are at the core of the entire interactomics system of any living cell and so, unsurprisingly, aberrant PPIs are on the basis of multiple diseases, such as Creutzfeld-Jacob, Alzheimer's disease, and cancer.PPIs have been studied from different perspectives: biochemistry, quantum chemistry, molecular dynamics, signal transduction, among others. All this information enables the creation of large protein interaction networks – similar to metabolic or genetic/epigenetic networks – that empower the current knowledge on biochemical cascades and disease pathogenesis, as well as provide putative new therapeutic targets.
  • studyres.com © 2026
  • DMCA
  • Privacy
  • Terms
  • Report