Survey
* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Nuclear magnetic resonance spectroscopy of proteins wikipedia , lookup
Homology modeling wikipedia , lookup
Immunoprecipitation wikipedia , lookup
Protein structure prediction wikipedia , lookup
Protein–protein interaction wikipedia , lookup
List of types of proteins wikipedia , lookup
Protein purification wikipedia , lookup
Protein mass spectrometry wikipedia , lookup
Degradomics wikipedia , lookup
Ribosomally synthesized and post-translationally modified peptides wikipedia , lookup
TMPRSS4 antibody - middle region (ARP49463_P050) Data Sheet Product Number Product Name Size Gene Symbol Alias Symbols Nucleotide Accession# Protein Size (# AA) Molecular Weight Product Format NCBI Gene Id Host Clonality Official Gene Full Name Gene Family Description Peptide Sequence Description of Target ARP49463_P050 TMPRSS4 antibody - middle region (ARP49463_P050) 50ug TMPRSS4 MT-SP2; TMPRSS3; CAPH2 NM_001083947 432 amino acids 48kDa Lyophilized powder 56649 Rabbit Polyclonal Transmembrane protease, serine 4 TMPRSS This is a rabbit polyclonal antibody against TMPRSS4. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Synthetic peptide located within the following region: LSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGS This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pancreatic carcinoma. The encoded protein is membrane bound with a N-terminal anchor sequence and a glycosylated extracellular region containing the serine protease domain. Multiple transcript variants encoding different isoforms have been found for this gene. Reconstitution and Storage Lead Time Blocking Peptide Add 50 ul of distilled water. Final anti-TMPRSS4 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Immunogen The immunogen for anti-TMPRSS4 antibody: synthetic peptide directed towards the middle region of human TMPRSS4 Swissprot Id Protein Name Protein Accession # Purification Species Reactivity Application Predicted Homology Based on Immunogen Sequence Q9NRS4-2 Domestic: within 24 hours delivery International: 3-5 business days For anti-TMPRSS4 antibody is Catalog # AAP49463 (Previous Catalog # AAPP29182) Transmembrane protease serine 4 NP_001077416 Affinity Purified Human, Mouse, Rat, Dog, Pig, Horse WB Human: 100%; Mouse: 93%; Rat: 86%; Dog: 85%; Pig: 85%; Horse: 85% Human HepG2 WB Suggested Anti-TMPRSS4 Antibody Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysate Image 1 __________________________________________________________________________________________________________________________________________________________________ This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.