Survey
* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
ANÀLISI GENÈTICA I MOLECULAR DE LES MIGRANYES HEREDITÀRIES memòria presentada per: Ester Cuenca León Per optar al grau de: Doctora per la Universitat de Barcelona bienni 2000-2002 Aquest treball ha estat realitzat sota la direcció del Dr. Alfons Macaya Ruiz i el Dr. Bru Cormand Rifà, al Laboratori de Neurologia Infantil i Psiquiatria Genètica de la Unitat de Neurologia Infantil de l’Hospital Universitari Vall d’Hebron i al Departament de Genètica de la Universitat de Barcelona. BARCELONA Dr. Alfons Macaya Ruiz Dr. Bru Cormand Rifà Ester Cuenca León RESULTATS CAPÍTOL 1 FAMILIAL HEMIPLEGIC MIGRAINE: LINKAGE TO CHROMOSOME 14q32 IN A SPANISH KINDRED E. Cuenca-León, R. Corominas, M. Montfort, J. Artigas, M. Roig, M. Bayés, B. Cormand, A. Macaya. ARTICLE 1 NEUROLOGY - SOTMÈS Capítol 1 – Article 1 RESULTATS RESUM Migranya hemiplègica familiar: lligament a 14q32 en una família espanyola. Objectius: Localització del gen responsable de la malaltia en una família extensa amb migranya hemiplègica familiar (FHM), migranya amb aura (MA) i migranya sense aura (MO). Mètodes: Es van obtenir mostres d’ADN de 20 familiars. Els pacients es van classificar en les variants específiques de migranya seguint els criteris de l’ICHD-II. Després d’excloure el lligament als loci de migranya prèviament descrits, es va dur a terme una anàlisi de lligament a escala genòmica mitjançant polimorfismes d’un sol nucleòtid (SNPs) amb una densitat de 0,62cM. Resultats: Dels 13 individus afectats, sis presentaven FHM com a fenotip migranyós predominant, dos mostraven MA i tres MO. S’ha identificat un nou locus per a la malatia en un segment de 4,15 Mb a la regió cromosòmica 14q32, amb un valor màxim de LOD score paramètric de 3,1 a l’anàlisi de dos punts i de 3,8 a l’anàlisi multipuntual. Aquesta regió genòmica no correspon al locus 14q21-22 prèviament descrit. Hi ha diversos gens candidats en aquesta regió. L’anàlisi de seqüència d’un d’ells, el gen SLC24A4, que codifica una proteïna intercanviadora de sodi/calci/potassi, no va permetre la identificació de cap mutació responsable del fenotip en els pacients. Conclusions: La identificació d’un nou locus genètic de FHM reforça el seu caràcter monogènic i insinua una major heterogeneïtat genètica de la que se sospitava prèviament. Tot i que, a més del nostre, s’han descrit diversos loci de susceptibilitat a migranya a la regió 14q, no hem pogut identificar encara el gen responsable del fenotip a la nostra família. 71 Capítol 1 – Article 1 RESULTATS Familial Hemiplegic Migraine: Linkage to chromosome 14q32 in a large Spanish kindred E. Cuenca-León BS, R. Corominas BS, M. Montfort PhD, J. Artigas MD, M. Roig MD, M. Bayés PhD, B. Cormand PhD, A. Macaya MD. From the Grup de Recerca en Neurologia Infantil i Psiquiatria Genètica, Hospital Universitari Vall d’Hebron, Barcelona (E.C-L., R.C., M.R., A.M.), Corporació Sanitària Parc Taulí, Sabadell (J.A.), Genes and Disease Program, Center for Genomic Regulation (CRG), UPF, Barcelona (M.M., M.B.) CIBER Epidemiología y Salud Pública, Instituto de Salud Carlos III (CRG), Barcelona (M.M., M.B.), Centro Nacional de Genotipado (CeGen), Barcelona (M.M., M.B.), Departament de Genètica, Facultat de Biologia, Universitat de Barcelona (B.C.), CIBER Enfermedades Raras, Instituto de Salud Carlos III, Barcelona (B.C.), Institut de Biomedicina de la Universitat de Barcelona (IBUB) (B.C.), Barcelona, Spain Supported by grants of Ministerio de Educación y Ciencia SAF 2003/04704, SAF200613893-C02-01 and Fundació La Marató de TV3 061330, Spain. E.C.-L. is funded by Ministerio de Educación y Ciencia and R.C. by Institut de Recerca Vall d’Hebron, Spain Supplemental Data Correspondence: Alfons Macaya, MD Grup de Recerca en Neurologia Infantil i Psiquiatria Genètica Hospital Universitari Vall d’Hebron Pg. Vall d’Hebron 119-129, 08035 Barcelona, Spain 73 RESULTATS Lligament genètic Tel. +34 93 4894334 Fax: +34 93 2746837 Email: [email protected] Abstract word count: 199 Manuscript word count: 1994 Title character count: 84 Disclosure: The authors report no conflicts of interest Statistical Analysis conducted by Ester Cuenca BS, Grup de Recerca en Neurologia Infantil i Psiquiatria Genètica, Hospital Universitari Vall d’Hebron, Barcelona, and Bru Cormand PhD, Departament de Genètica, Facultat de Biologia, Universitat de Barcelona, Spain Supplemental data: Supplemental Table: CuencaET1, E-Table 1, Supplemental Figure: CuencaEF1, E-Figure 1. Search terms: All Genetics [91], Genetic linkage [94], Migraine [101] 74 RESULTATS Capítol 1 – Article 1 Abstract Objective: To map the disease-causing gene in a large Spanish kindred with familial hemiplegic migraine (FHM), migraine with aura (MA) and migraine without aura (MO). Methods: DNA samples from 20 family members were obtained. Patients were classified according to ICHD-II criteria for specific migraine subtypes. After ruling out linkage to known migraine genetic loci, a single nucleotide polymorphism (SNP)-based, 0.62 cM density genomewide scan was performed. Results: In 13 affected subjects, FHM was the prevailing migraine phenotype in six, MA in four and MO in three. Linkage analysis revealed a disease locus in a 4.15 Mb region on 14q32, with a maximum two-point LOD score of 3.1 and a multipoint parametric LOD score of 3.8. This genomic region does not overlap with reported migraine loci on 14q21-22. Several candidate genes map to this region. Sequence analysis of one of them, SLC24A4, encoding a potassium-dependent sodium/calcium exchanger, failed to show disease-causing mutations in our patients. Conclusions: The finding of a new genetic locus in FHM underscores its monogenic character and hints to greater genetic heterogeneity than previously suspected. While several genes conferring increased susceptibility to migraine seem to reside on 14q, the underlying disease-causing gene in our family remains unidentified. 75 RESULTATS Lligament genètic Introduction Familial hemiplegic migraine (FHM) is a rare subtype of migraine with aura (MA) with autosomal dominant inheritance. In combination with sporadic hemiplegic migraine (SHM), the condition has a prevalence of 0.01%.1 Three FHM genes have been identified, its dysfunction resulting in increased synaptic glutamate and a lower threshold for cortical spreading depression, the mechanism underlying migraine aura. 2,3 In FHM1, mutations in the CACNA1A gene on chromosome 19p13.13, encoding the α subunit of the neuronal P/Q-type calcium channel (CACNA1A), were first reported in five unrelated FHM families.4 To date, at least 21 CACNA1A mutations have been reported.5 FHM2 is caused by mutations in the ATP1A2 gene on chromosome 1q23.2; over 30 FHM2 mutations have been identified.6-8 Only three FHM3 mutations have been described in the SCN1A gene, which encodes the α subunit of the neuronal voltage-gated type I sodium channel.9-11 Mutations in these three genes account for just 50-70% of published cases of FHM. A recent population-based study from Denmark indicated greater locus heterogeneity than previously assumed.12 In migraine families, previous genomewide linkage scans have detected loci for MA on 4q24 , 11q24,13,14 for migraine without aura (MO) or MA on 6p12-2115 and for MO on 4q21 and 14q21.2-22.3.16,17 A locus on 9q21-q22 has been linked to familial occipitotemporal lobe epilepsy in a pedigree showing MA co-occurrence in five out of ten affected members.18 Two studies using latent class analysis of migraine symptoms identified a locus on 5q21 for the cluster photophobia – phonophobia19 and putative loci on 3q29 and 18p11 for the severe migraine phenotype.20 We performed a genomewide scan in a Spanish FHM multigenerational family and obtained conclusive linkage to a novel single genetic locus on chromosome 14q32.1232.13. 76 Capítol 1 – Article 1 RESULTATS Methods Patients: A multigenerational FHM family from Catalunya, North-Eastern Spain, was assessed. All participants were directly interviewed by one of the authors (AM); migraine clinical diagnosis was established according to the ICHD-II criteria from the IHS.21 For genetic analysis, any member meeting IHS criteria for a type of migraine headache was given an affected status. Samples: DNA was extracted from peripheral blood of 20 available family members using the QIAamp DNA Blood Maxi Kit (Hilden, GE). Written informed consent from participants and approval from the local Ethics Committee were obtained according to the guidelines of the Helsinki Declaration. DNA analysis: Linkage between the migraine phenotype in our family and each one of six previously reported migraine genetic loci on 1q21-23,22 1q31-32,23 4q24,13 6p12.2p21.1,15 14q21.2-22.317 and 19p.1324 was assessed. These loci were covered with 20 microsatellite markers mainly from the MD-10 Linkage Mapping Set v2.5 (Applied Biosystems, Foster City, CA) and genotypes resolved by polyacrylamide gel electrophoresis and silver staining following standard methods. Next, samples were genotyped with the SNP-based Linkage IVb Gold Panel (Illumina, San Diego, CA) comprising 6,008 SNP markers evenly distributed across the genome. Each sample was genotyped in four highly multiplexed assays following the manufacturer’s recommendations. The Illumina’s BeadArray Reader was used to analyze fluorescence signals, and the Illumina’s BeadStudio GenoTyping Module v.2.1.10 to normalize raw data, perform clustering and generate genotype calls. The coding regions of the SLC24A4 gene were PCR-amplified, purified and sequenced (ABI PRISM 3700 DNA Analyzer, Applied Biosystems, Foster City, CA). See E-Table 1 for primer sequences and product sizes. 77 RESULTATS Lligament genètic Statistical analysis: The simulation program SLINK25-27 was used to compute the maximum expected pairwise LOD score (Z) in our pedigree, assuming an autosomal dominant model of inheritance with a penetrance (p) of 0.95, a phenocopy rate (f) of 0.01, a disease allele frequency (q) of 0.001 and a marker heterozygosity of 0.5 over 1000 replicates. The family was estimated to give a maximum two-point LOD score (Zmax) of 4.04 at a recombination fraction (θ) of 0.00 from the disease gene. The evaluation of previously reported migraine loci was performed by multipoint parametric linkage analysis between microsatellite markers and the disease phenotype using the LINKMAP software from the LINKAGE package28 with p = 0.95, f = 0.01 and q = 0.001 under a dominant model. The genomewide scan for linkage between SNP markers and migraine was performed by multipoint parametric linkage analysis, assuming 0.8 ≤ p ≤ 1.0, 0.01 ≤ f ≤ 0.10 and q = 0.001 under dominance. Exponential multipoint non-parametric linkage (NPL) analysis was also performed to detect increased allele sharing among affected individuals, without assumption of any inheritance model. Both calculations were computed with MERLIN29 on a split pedigree to circumvent program constraints. Finally, the critical disease interval was studied in more detail in the full pedigree by both two-point linkage analysis using the MLINK program, and also by multipoint parametric linkage analysis using LINKMAP and the “sliding window” method to avoid loss of information. Several values of penetrance and phenocopy rate were assumed under dominance. Both programs are implemented in the LINKAGE package.28 To define the boundaries of the critical interval, haplotypes were constructed with MERLIN29 by minimizing the number of recombination events. For the genomewide screen, the SNP allele frequencies were considered to be equal, while for the analysis of the critical interval on chromosome 14, Caucasoid allele frequencies from the Central European (CEU) HapMap database were used (www.hapmap.org). 78 RESULTATS Capítol 1 – Article 1 Results A three-generation pedigree with 13 affected and 7 healthy individuals was analyzed (Figure 1). The 16-year-old proband (III.12) was the youngest FHM patient, with episodes starting at age 12. She had five relatives diagnosed with FHM, including her mother and two siblings, four with the main diagnosis of MA and three with MO. The pedigree’s detailed clinical data are shown in Table 1; all subjects fulfilled ICHD-II criteria regarding number and duration (4-72 hours) of episodes. Clinical diagnosis in family members with MA ranged from typical visual aura with migraine headache in individual II.10 to visual aura with non-migraine headache in II.12 and typical aura without ensuing headache in III.16. Patient II.13 had simultaneous bilateral paresthesia, the occasional feature of FHM and of basilar-type migraine, occurring as the single aura manifestation. Most patients presented in childhood or early puberty and, overtime, five patients displayed more than one subtype of migraine. Interictal neurological examination was normal in all cases; specifically, no cerebellar signs were recorded. Brain MRI in the proband and in patients II.3 and II.13, were normal. No patient or non-migraneur in the pedigree displayed ataxia, seizures or any other paroxysmal neurological sign. Multipoint analysis encompassing six loci previously linked to migraine allowed exclusion of linkage to five of them (Z < -2.0) in our pedigree and displayed negative scores (Z < -0.6) at the 4q24 locus (E-Figure 1). The results of linkage to 5,627 autosomal SNPs are shown in Figure 2; sex-linked inheritance was ruled out in this pedigree. The average genotype call rate was 99.58 (±1.52) % after excluding 36 SNPs (0.64%) with genotype calls <80%. Evidence of linkage to chromosome 14q32.12-32.13 was found. The highest two-point LOD score value was obtained with marker rs882023 (Zmax = 3.11 at θ = 0.00), with several close markers preserving positive LOD scores, under the assumption of 95% penetrance and 1% phenocopy rate (Table 2). In line was the multipoint parametric linkage analysis 79 RESULTATS Lligament genètic which provided strong evidence of linkage between markers rs972905 and rs1054195 (Z > 3), with a maximum LOD score of 3.83 at markers rs742893 and rs1054195 (Figure 3). No other region in the whole genome surpassed a LOD score value of 1 and, indeed, 95.7% of the genome was ruled out to hold the causative gene (Z < -2). Exponential NPL analysis reached its highest value in the same region of chromosome 14 (Z = 2.71, p = 0.0002). The limits of the disease-causing haplotype, spanning 4.15 Mb, were set by a proximal recombination between rs755102 and rs972905 in III.16, a MA patient, and a distal recombination between rs1054195 and rs1007813 in III.10, a FHM patient. It was shared by all the affected members while the unaffected members carried a different haplotype (Figure 1). The only exception was individual III.14, a 12 year-old boy that either was presymptomatic at the time of the study or displayed incomplete penetrance of the disease phenotype. The SLC24A4 gene, encoding a potassium-dependent sodium/calcium exchanger (NCKX4) is located within the critical interval, around 1 Mb distal from rs755102. Sequence analysis of all exons and intronic flanking regions of the gene was carried out in affected individuals, but no potential disease-causing mutations were found. Discussion Whole-genome linkage analysis on a single multigenerational dominant pedigree revealed a novel FHM locus on 14q32, although the underlying gene remains to be identified. The prevailing phenotype of the affected members in this family was FHM, without associated episodic or progressive ataxia; the seven cases of MA or MO were considered as affected in the linkage calculations, since occurrence of non-hemiplegic migraine within FHM pedigrees is well acknowledged. Indeed, co-occurrence of MO and MA is observed in some FHM patients during their lifetime, both in our family and in other reports.12 In addition, mutations in the CACNA1A gene are often expressed as MA30,31 or MO,32 although certainly FHM1 does not appear to be a major susceptibility 80 Capítol 1 – Article 1 RESULTATS locus for non-hemiplegic migraine.14,33,34 That dissimilar migraine phenotypes may share the same molecular defect is also illustrated by some FHM2 pedigrees, where mutations in the ATP1A2 gene have been reported in MA or MO individuals.35,36 All the affected members of the pedigree shared a common haplotype spanning 4.15 Mb, regardless of their specific migraine phenotype (FHM, MA, MO). Only one asymptomatic individual (III.14) was a carrier of the disease haplotype, and the question remains whether he will develop migraine symptoms in the future. Using the stringent phenotype FHM-only, the haplotypes segregating with the disease defined a wider disease-harboring interval of about 28 Mb (between rs1015023 and rs1007813) that included the 4.15 Mb region defined when patients with FHM or MA, or patients with any of the three migraine phenotypes, were considered. A recombination in individual III.10, an FHM individual, defined the distal limit of the smaller critical region, whereas III.16, a MA patient, defined the proximal border. The newly identified locus shows no overlap with a previous one described on chromosome 14q21 in a large Italian MO family.17 Considering the disease-associated haplotypes in each family, the two loci are more than 30 Mb apart. A latent class analysis in families from Australia20 found suggestive linkage of migraine symptoms to a locus on 14q22 (Z = 2.06, p = 0.002), in close proximity (< 5cM) to the critical region in the above mentioned Italian family. Again, the locus does not overlap with the one described here, although it is conceivable that a cluster of genes conferring increased susceptibility to migraine may reside in this region on chromosome 14q. The UCSC Human Genome Browser database (genome.ucsc.edu, NCBI Build 36.1) lists 47 genes within the critical disease interval. One of them, SLC24A4 [OMIM 609840], encoding a multi-pass membrane protein for ion exchange, was screened on the basis of its genomic position, expression profile and function. Even though we failed to detect putative disease-causing mutations, the possibility remains of changes outside the coding region or that may have gone undetected by PCR and direct sequencing. Also in the region is the ATXN3 gene [OMIM 607047] encoding ataxin 3, 81 RESULTATS Lligament genètic whose expansion at a (CAG)n repeat is responsible for Machado - Joseph disease (SCA3).37 FHM-causing mutations in this gene would match the pattern associated with CACNA1A mutations, which cause both FHM1 and SCA6. Other candidate genes are FBLN5 [OMIM 604580], encoding fibulin5, a calcium binding protein expressed in arterial vasculature and ITPK1 [OMIM 601838], encoding inositol 1,3,4-triphosphate kinase, which indirectly regulates plasma membrane Ca2+-activated chloride channels. Linkage to a single locus in our family adds to the existing evidence that FHM is usually inherited as a monogenic defect and that genetic heterogeneity in FHM appears to be greater than previously suspected. Further studies are warranted to ascertain the relevance of this locus in other large migraine families. Identification of the disease gene in the locus described here may lead to a better understanding of the complex molecular mechanisms involved in this condition. References 1. Thomsen LL, Olesen J. Sporadic hemiplegic migraine. Cephalalgia 2004;24:1016-1023. 2. Goadsby PJ. Recent advances in understanding migraine mechanisms, molecules and therapeutics. Trends Mol Med 2007;13:39-44. 3. Wessman M, Terwindt GM, Kaunisto MA, Palotie A, Ophoff RA. Migraine: a complex genetic disorder. Lancet Neurol 2007;6:521-532. 4. Ophoff RA, Terwindt GM, Vergouwe MN, et al. Familial hemiplegic migraine and episodic ataxia type-2 are caused by mutations in the Ca2+ channel gene CACNL1A4. Cell 1996;87:543-552. 5. Cuenca-León E, Corominas R, Fernández-Castillo N, et al. Genetic analysis of 27 Spanish patients with hemiplegic migraine, basilar-type migraine and childhood periodic syndromes. Cephalalgia (in press). 6. 82 Pietrobon D. Familial hemiplegic migraine. Neurotherapeutics 2007;4:274-284. Capítol 1 – Article 1 7. RESULTATS Tonelli A, Gallanti A, Bersano A, et al. Amino acid changes in the amino terminus of the Na,K-adenosine triphosphatase alpha-2 subunit associated to familial and sporadic hemiplegic migraine. Clin Genet 2007;72:517-523. 8. Jen JC, Klein A, Boltshauser E, et al. Prolonged hemiplegic episodes in children due to mutations in ATP1A2. J Neurol Neurosurg Psychiatry 2007;78:523-526. 9. Dichgans M, Freilinger T, Eckstein G, et al. Mutation in the neuronal voltagegated sodium channel SCN1A in familial hemiplegic migraine. Lancet 2005;366:371-377. 10. Vanmolkot KR, Babini E, de Vries B, et al. The novel p.L1649Q mutation in the SCN1A epilepsy gene is associated with familial hemiplegic migraine: genetic and functional studies. Hum Mutat [Mutation in brief #957 online] 2007;28:522. Available at: www.interscience.wiley.com. Accessed December 4, 2007 11. Gargus JJ, Tournay A. Novel Mutation Confirms Seizure Locus SCN1A is Also Familial Hemiplegic Migraine Locus FHM3. Pediatr Neurol 2007;37:407-410. 12. Thomsen LL, Kirchmann M, Bjornsson A, et al. The genetic spectrum of a population-based sample of familial hemiplegic migraine. Brain 2007;130:346356. 13. Wessman M, Kallela M, Kaunisto MA, et al. A susceptibility locus for migraine with aura, on chromosome 4q24. Am J Hum Genet 2002;70:652-662. 14. Cader ZM, Noble-Topham S, Dyment DA, et al. Significant linkage to migraine with aura on chromosome 11q24. Hum Mol Genet 2003;12:2511-2517. 15. Carlsson A, Forsgren L, Nylander PO, et al. Identification of a susceptibility locus for migraine with and without aura on 6p12.2-p21.1. Neurology 2002;59:1804-1807. 16. Bjornsson A, Gudmundsson G, Gudfinnsson E, et al. Localization of a gene for migraine without aura to chromosome 4q21. Am J Hum Genet 2003;73:986993. 83 RESULTATS 17. Lligament genètic Soragna D, Vettori A, Carraro G, et al. A locus for migraine without aura maps on chromosome 14q21.2-q22.3. Am J Hum Genet 2003;72:161-167. 18. Deprez L, Peeters K, Van Paesschen W, et al. Familial occipitotemporal lobe epilepsy and migraine with visual aura: linkage to chromosome 9q. Neurology 2007;68:1995-2002. 19. Nyholt DR, Morley KI, Ferreira MA, et al. Genomewide significant linkage to migrainous headache on chromosome 5q21. Am J Hum Genet 2005;77:500512. 20. Lea RA, Nyholt DR, Curtain RP, et al. A genomewide scan provides evidence for loci influencing a severe heritable form of common migraine. Neurogenetics 2005;6:67-72. 21. The International Classification of Headache Disorders: 2nd edition. Cephalalgia 2004;24(suppl 1):9-160. 22. Marconi R, De Fusco M, Aridon P, et al. Familial hemiplegic migraine type 2 is linked to 0.9Mb region on chromosome 1q23. Ann Neurol 2003;53:376-381. 23. Gardner K, Barmada MM, Ptacek LJ, Hoffman EP. A new locus for hemiplegic migraine maps to chromosome 1q31. Neurology 1997;49:1231-1238. 24. Nyholt DR, Lea RA, Goadsby PJ, Brimage PJ, Griffiths LR. Familial typical migraine: linkage to chromosome 19p13 and evidence for genetic heterogeneity. Neurology 1998;50:1428-1432. 25. Ott J. Computer-simulation methods in human linkage analysis. Proc Natl Acad Sci U S A 1989;86:4175-4178. 26. Weeks D, Ott J, Lathrop G. SLINK: a general simulation program for linkage analysis. Am J Hum Genet 1990;47:A204. Abstract. 27. Cottingham RW, Jr., Idury RM, Schaffer AA. Faster sequential genetic linkage computations. Am J Hum Genet 1993;53:252-263. 28. Terwilliger J, Ott J. Handbook of human genetic linkage, 1st ed. Baltimore: The Johns Hopkins University Press, 1994 84 Capítol 1 – Article 1 29. RESULTATS Abecasis GR, Cherny SS, Cookson WO, Cardon LR. Merlin--rapid analysis of dense genetic maps using sparse gene flow trees. Nat Genet 2002;30:97-101. 30. Terwindt GM, Ophoff RA, Haan J, et al. Variable clinical expression of mutations in the P/Q-type calcium channel gene in familial hemiplegic migraine. Dutch Migraine Genetics Research Group. Neurology 1998;50:1105-1110. 31. Ducros A, Denier C, Joutel A, et al. The clinical spectrum of familial hemiplegic migraine associated with mutations in a neuronal calcium channel. N Engl J Med 2001;345:17-24. 32. Kors EE, Haan J, Giffin NJ, et al. Expanding the phenotypic spectrum of the CACNA1A gene T666M mutation: a description of 5 families with familial hemiplegic migraine. Arch Neurol 2003;60:684-688. 33. Lea RA, Curtain RP, Hutchins C, Brimage PJ, Griffiths LR. Investigation of the CACNA1A gene as a candidate for typical migraine susceptibility. Am J Med Genet 2001;105:707-712. 34. Jen JC, Kim GW, Dudding KA, Baloh RW. No mutations in CACNA1A and ATP1A2 in probands with common types of migraine. Arch Neurol 2004;61:926928. 35. De Fusco M, Marconi R, Silvestri L, et al. Haploinsufficiency of ATP1A2 encoding the Na+/K+ pump alpha2 subunit associated with familial hemiplegic migraine type 2. Nat Genet 2003;33:192-196. 36. Vanmolkot KR, Kors EE, Hottenga JJ, et al. Novel mutations in the Na+, K+ATPase pump gene ATP1A2 associated with familial hemiplegic migraine and benign familial infantile convulsions. Ann Neurol 2003;54:360-366. 37. Kawaguchi Y, Okamoto T, Taniwaki M, et al. CAG expansions in a novel gene for Machado-Joseph disease at chromosome 14q32.1. Nat Genet 1994;8:221228. 85 RESULTATS Lligament genètic FIGURE LEGENDS Figure 1. Spanish migraine pedigree showing haplotypes for 20 SNP markers on chromosome 14q24.1 - 14q32.31. The haplotypes segregating with the disease phenotype are boxed. The names and order of the markers are depicted in the inset, with the genetic distances between them indicated in cM. FHM= familial hemiplegic migraine, MA= migraine with aura, MO= migraine without aura. Figure 2. Whole-genome parametric multipoint linkage analysis between the disease phenotype and 5,627 autosomal SNPs from the Linkage IVb Gold Panel (Illumina, San Diego, CA). The -2 and +3 LOD score thresholds are indicated with horizontal lines within the graph. The arrow shows the linked area on chromosome 14q32. Figure 3. Parametric multipoint linkage analysis between the disease phenotype and 12 SNP markers on chromosome 14q31-q32. The marker names are indicated on the top of the graph. The LOD scores, on the y-axis, were calculated with the LINKMAP software assuming different penetrance (p) and phenocopy (f) values, which are indicated in % in the inset. The -2 and +3 LOD score thresholds are indicated with horizontal lines within the graph. On the x-axis, genetic distances in cM from the 14p telomere, as defined in the Linkage IVb Gold Panel (Illumina, San Diego, CA) and in the deCODE Genetics recombination map (www.decode.com). 86 Capítol 1 – Article 1 Table 1. Patients clinical features. Individual Sex Age at onset (years) Unilateral pain Pulsating pain Aggravation by physical activity Pain intensity Nausea Vomiting Photophobia Phonophobia Highest attack frequency Visual disturbances Language disturbances Sensory / Motor deficit Ataxia Vertigo Clinical diagnosis (ICHD-II code) I.2 II.2 II.3 II.8 II.10 II.12 II.13 III.3 III.5 III.10 III.11 III.12 III.16 F 14 Yes Yes Yes NA No No Yes Yes F 28 Yes Yes Yes NA No No Yes Yes F 13 No Yes Yes NA No No Yes Yes F 12 Yes Yes Yes NA No No Yes Yes F 10 No Yes Yes Disabling Yes Yes Yes Yes M 16 No Yes No Disabling No No No Yes F 12 Yes Yes Yes Disabling Yes No Yes Yes F 5 Yes Yes Yes NA No No Yes Yes M 12 Yes Yes Yes NA No No Yes Yes M 10 No No Yes NA Yes Yes No Yes F 12 Yes No Yes NA Yes Yes Yes Yes F 7 No No No Moderate No No No No 2/month 2/week 5 FHM/year, 2 MO/month 2/year 1/month 2/year 2/month F 5 Yes Yes NA NA Yes Yes No Yes 3 FHM overall, 1 MO/week 1/month 3/year 6/year 2/month 2/month No No No No No No No No No No yes yes Yes/Yes No No yes yes Yes/Yes No No yes No No No No yes No No No No No No Yes/No No No yes no Yes/Yes No No No No No No No yes yes Yes/Yes No No yes yes Yes/Yes No No Yes Yes Yes/Yes No No Yes No No No Yes MO (1.1) MO (1.1) FHM (1.2.4) MO (1.1) FHM (1.2.4) MA (1.2.1) MO (1.1) MA (1.2.1), MO (1.1) MA (1.2.2) MA (1.2.1), MO (1.1) FHM (1.2.4) MO(1.1) MO (1.1) FHM (1.2.4) FHM (1.2.4) FHM (1.2.4) MA (1.2.3) NA= not available; FHM= familial hemiplegic migraine, MA= migraine with aura, MO= migraine without aura RESULTATS 87 Position Marker cM Mb LOD score at θ = 0.00 0.01 0.05 0.10 0.20 0.30 0.40 Zmax θmax rs1999916 84.31 85.53 -2.12 -0.75 0.15 0.53 0.69 0.54 0.26 0.69 0.19 rs719572 87.25 88.45 -2.40 -0.76 -0.01 0.29 0.46 0.38 0.17 0.46 0.21 rs972905 94.46 91.27 1.74 1.71 1.61 1.47 1.18 0.84 0.45 1.74 0.00 rs882023 96.43 92.60 3.11 3.06 2.84 2.56 1.94 1.26 0.53 3.11 0.00 rs1004958 99.39 94.11 1.78 1.75 1.63 1.46 1.11 0.71 0.27 1.78 0.00 rs742893 99.69 94.22 1.01 1.05 1.14 1.15 1.01 0.76 0.42 1.15 0.08 rs1054195 101.33 94.72 1.78 1.75 1.62 1.46 1.11 0.71 0.27 1.78 0.00 rs1007813 102.71 95.08 1.22 1.25 1.32 1.31 1.15 0.86 0.48 1.33 0.07 rs2369522 104.11 95.81 1.94 1.92 1.80 1.64 1.31 0.93 0.50 1.94 0.00 rs1159799 109.62 98.32 0.94 0.93 0.91 0.86 0.72 0.54 0.30 0.94 0.00 rs941731 112.31 98.96 -1.77 -1.28 -0.64 -0.36 -0.22 -0.23 -0.14 0.00 0.50 rs1007904 117.78 101.03 -2.99 -1.40 -0.72 -0.45 -0.20 -0.08 -0.02 0.00 0.50 RESULTATS 88 Table 2. Two-point LOD scores between migraine (FHM, MA, MO) and chromosome 14q31-q32 markers. Lligament genètic Capítol 1 – Article 1 RESULTATS Figure 1 89 Lligament genètic Figure 2 RESULTATS 90 Capítol 1 – Article 1 RESULTATS 91 RESULTATS Lligament genètic Figure 3 (Z) 92 RESULTATS Capítol 1 – Article 1 E-Table 1 93 MIGRANYA AMB AURA: LLIGAMENT A 14q EN UNA FAMILIA AUTOSÒMICA DOMINANT EXTENSA ANNEX A L’ARTICLE 1 Capítol 1 – Annex a l’article 1 RESULTATS RESUM Migranya amb aura: lligament a 14q en una família autosòmica dominant extensa Amb l’objectiu final d’identificar el gen responsable d’una forma freqüent de migranya en una família autosòmica dominant extensa, s’ha realitzat un cribratge genòmic per anàlisi de lligament. La família té 30 individus en quatre generacions, set d’ells afectats de migranya amb aura (MA) i set amb migranya sense aura (MO). La identificació d’un haplotip compartit pels membres afectats de la família ha permès localitzar el gen de la malaltia a una regió de 19,45Mb a 14q24.3-34.2. L’interval de 4,15Mb identificat prèviament a 14q32.12-32.13 en una altra família amb individus amb FHM, MA i MO (Article 1), està inclòs en aquesta regió. Es va realitzar l’anàlisi mutacional del gen SLC24A4, un candidat posicional i funcional que codifica una proteïna intercanviadora de sodi/calci/potassi, en dos individus afectats de la família i portadors de l’haplotip de risc per la malaltia i no es va detectar cap canvi potencialment patogènic. El fet que la regió de lligament a migranya en aquesta família inclogui un locus prèviament descrit lligat a un fenotip més greu de la mateixa malaltia suggereix una causa genètica comú en variants diferents de migranya. Seria interessant reclutar altres famílies migranyoses amb herència autosòmica dominant per intentar identificar lligaments al mateix locus que permetin acotar encara més la regió genòmica crítica. 97 RESULTATS Capítol 1 – Annex a l’article 1 MIGRANYA AMB AURA: LLIGAMENT A 14q EN UNA FAMÍLIA AUTOSÒMICA DOMINANT EXTENSA Consideracions generals Donat que es desconeix la base genètica de les formes comuns de migranya i que vam poder identificar una família de 30 individus que inclou membres MA i MO en què la migranya segrega aparentment de forma autosòmica dominant (figura 1), ens vam plantejar dur a terme un estudi de lligament a escala genòmica. El fet de poder utilitzar una única família de grans dimensions permet evitar els problemes potencials d’heterogeneïtat genètica inherents al fenotip migranyós. I.1 II.1 III.1 III.1 1 6 2 3 1 2 3 4 IV.1 III.2 3 6 1 4 1 1 3 3 1 3 5 5 4 4 1 3 IV.2 4 1 6 4 3 2 1 4 III.4 III.5 2 8 5 3 3 4 1 3 1 6 3 6 1 1 1 4 2 5 6 2 1 1 1 2 IV.4 IV.5 IV.6 IV.7 IV.8 1 6 2 3 1 2 3 4 4 1 6 4 3 2 1 4 4 1 6 4 3 2 1 4 4 6 7 3 2 4 3 1 4 6 7 3 2 4 3 1 4 6 7 3 2 4 3 1 2 5 6 2 1 1 1 2 II.3 4 6 7 3 2 4 3 1 IV.3 3 6 1 4 1 1 3 4 II.2 III.3 4 1 6 4 3 2 1 4 2 5 6 2 1 1 1 2 2 5 5 3 3 4 1 3 2 8 5 3 3 4 1 2 IV.9 2 8 5 3 3 4 1 3 I.2 III.6 1 7 4 5 1 4 1 3 IV.10 IV.11 1 6 3 6 1 1 1 3 1 7 4 5 1 1 1 4 3 6 1 4 1 1 3 2 III.7 3 6 1 4 1 1 3 3 5 6 4 3 1 1 1 2 IV.12 1 6 3 6 1 1 1 3 5 6 4 3 1 2 1 3 1 9 2 1 2 2 3 1 IV.13 1 7 4 5 1 4 1 3 3 6 1 4 1 1 3 3 IV.14 5 6 6 2 1 1 2 2 III.8 5 6 4 3 1 2 1 2 5 6 6 2 1 1 2 2 IV.15 III.9 2 4 3 4 1 3 5 3 3 6 1 4 1 1 3 3 IV.16 IV.17 IV.18 1 9 6 2 1 1 3 1 5 6 6 2 1 1 2 1 5 6 6 2 1 1 2 2 3 6 1 4 1 1 3 3 3 6 1 4 1 1 3 3 5 6 4 3 1 2 1 2 3 6 4 3 1 2 1 2 III.10 6 5 3 3 3 1 3 2 5 6 4 3 1 2 1 2 IV.19 IV.20 3 6 1 4 1 1 3 1 5 6 4 3 1 2 1 2 2 5 3 3 3 1 3 2 2 4 3 4 1 3 5 3 II.4 III.11 III.12 3 6 1 4 1 1 3 1 2 2 8 6 1 4 1 1 IV.21 3 6 1 4 1 1 3 1 IV.22 IV.23 2 4 3 4 1 3 5 3 2 1 4 3 1 4 2 3 IV.24 2 2 8 6 1 4 1 1 GRUP EXCLÒS V.1 V.2 3 2 6 1 1 6 4 1 1 1 1 4 3 4 2 2 V.3 D14S59 D14S1037 D14S67 D14S68 D14S256 D14S1044 D14S280 D14S65 5,33 3,2 0,1 0,53 3,46 5,12 12,3 : MA, HOME : MO, DONA Figura 1. Estructura de la família estudiada amb els haplotips de 8 marcadors corresponents al locus del cromosoma 14. L’haplotip de risc per desenvolupar la malaltia es representa enquadrat. A la caixa s’especifica l’ordre dels marcadors i les distàncies entre ells en cM segons el mapa Marshfield (research.marshfieldclinic.org/genetics). La caixa amb línia discontínua emmarca els individus que, tot i genotipats, s’han exclòs de l’anàlisi de lligament. 99 V.4 4 6 1 4 1 1 3 3 RESULTATS Lligament genètic Pacients La família consta de 30 individus disponibles per a l’estudi, 14 d’ells afectats de migranya que compleixen els criteris ICHD-II de la IHS per MA (7 casos) o per MO (7 casos) (taula 1). L’individu índex (V.2) presentà des dels 10 dies de vida i amb una freqüència d’un cop al mes, episodis de disfunció neurològica aguda (hipotonia, postració) que en arribar als 3 anys d’edat, el pacient pot descriure com a dolor cefàlic intens unilateral que empitjora amb l’activitat física. Aquest individu, que encara està en edat pediàtrica, manifesta molt probablement una forma clínica precursora de migranya, i encara que no compleix els criteris ICHD-II, s’ha considerat com a afectat per a les anàlisis de lligament. L’individu III.7, afectat de MO, prové de fora de la família i es diferencia del tipus de cefalea present en la resta del pedigrí per l’inici tardà dels episodis, a l’edat de 30 anys. Aquest individu i els seus 5 fills (IV.14, IV.15, IV.16, IV.17 i IV.18) han estat exclosos dels càlculs de lligament, ja que, tenint en compte l’elevat grau d’heterogeneïtat genètica de la malaltia, és possible que l’individu III.7 transmeti a algun dels seus fills un al·lel mutant en un gen diferent al que és responsable de la patologia a la resta de la família. Avaluació de loci prèviament descrits mitjançant anàlisi de lligament genètic L’anàlisi haplotípica de loci prèviament lligats a migranya mitjançant polimorfismes de tipus microsatèl·lit va permetre excloure en aquesta família bona part dels 6 loci coneguts a l’inici d’aquest estudi. L’anàlisi de lligament multipuntual en 11 individus afectats de la família (taula 1), assumint una herència autosòmica dominant amb p=90% i f=10%, exclogué clarament els loci 4q24, 14q21-23 i gran part de 1q31-32 com a responsables del fenotip migranyós, i suggerí, sense assolir significació estadística, que els loci 6p12.2-p21.1 i 1q21-23 tampoc estaven implicats (figura 2). El sisè locus, a 19p13, conté el gen CACNA1A i es va excloure mitjançant anàlisi de lligament de dos punts utilitzant el marcador intragènic D19S1150, situat a l’intró 7 del gen CACNA1A. 100 Individu Sexe Edat d'inici dels símptomes (anys) >5 episodis 4 a 72h Dolor unilateral Dolor pulsatiu Empitjorament amb l'activitat física intensitat del dolor Nàusees Vòmits Fotofòbia Fonofòbia Freqüència màxima dels episodis Alteracions visuals Alteracions del llenguatge Alteracions sensorials/ motores Atàxia Vertigen Diagnòstic clínic (codi ICHD-II) III.2 F 10 Sí Sí No Sí Sí incapacitant ND ND Sí Sí 10/any Sí No No No No MA (1.2.1) III.3 M 20 Sí Sí No Sí Sí incapacitant No No Sí Sí 1-2/setm No No No No No MO (1.1) III.8 F 10 Sí Sí Sí Sí Sí incapacitant Sí Sí Sí Sí 3/setm No No No No Sí MO (1.1) III.10 F 10 Sí Sí No Sí Sí incapacitant Sí ND Sí Sí 1/mes Sí No No No No MA (1.2.1) IV.3 M 20 Sí Sí No Sí Sí moderada No No Sí Sí 4/any Sí No No No Sí MA (1.2.1) IV.5 F 16 Sí Sí Sí Sí Sí incapacitant Sí No Sí Sí 1/setm No No No No No MO (1.1) IV.10 F 10 Sí Sí Sí Sí Sí incapacitant No No Sí Sí 4/mes Sí No Sí No No MA (1.2.1) IV.13 F 5 Sí Sí Sí Sí Sí moderada Sí Sí Sí Sí 1/mes No No No No No MO (1.1) IV.19 M 12 Sí Sí No Sí Sí moderat No No Sí Sí 2-3/setm Sí No No No No MA (1.2.1) IV.24 F 7 Sí Sí No Sí Sí incapacitant No No Sí ND 1/setm No No No No Sí MO (1.1) V.2 F 10 dies Sí Sí Sí ? Sí incapacitant ? no ? ? 1/mes ? ? Capítol 1 – Annex a l’article 1 Taula 1. Simptomatologia clínica dels pacients inclosos en el cribratge a escala genòmica. NO IHS ND: no disponible, MA: migranya amb aura, MO: migranya sense aura RESULTATS 101 RESULTATS Lligament genètic M1 1q31- 32 M1 1q21-23 M1 4q24 M1 14q21-22 M1 6p12-22 M1 f 10% - p 90% Distància en cM 0 5 10 15 20 25 LOD score (Z) 0 -1 -2 -3 -4 Figura 2. Representació gràfica dels valors de LOD score multipuntuals obtinguts per a cinc dels sis loci autosòmics de migranya descrits a la literatura a l’inici de l’estudi. El sisè locus, 19p13, conté el gen CACNA1A i es va excloure utilitzant el marcador intragènic D19S1150. Els valors de LOD score s’han calculat mitjançant el programa GENEHUNTER i considerant p= 90% i f= 10%. L’ordre i distàncies entre marcadors es corresponen amb el mapa Marshfield (research.marshfieldclinic.org/genetics). Anàlisi de lligament genètic a escala genòmica Es va dur a terme un cribratge de tot el genoma en 11 dels 18 individus afectats de migranya de la família (5 MA i 6 MO) utilitzant 400 marcadors de tipus microsatèl·lit del Linkage Mapping Set v2.5-MD10 (Applied Biosystems) amb una densitat mitjana d’1 marcador/9 cM. Dels 18 individus afectats de la família, 7 no es van genotipar o no es van considerar a l’anàlisi de lligament per diverses raons: els individus II.2, II.4 i III.11 ja eren morts i no hi havia mostra biològica disponible, l’individu III.7, també afectat, no és descendent de la parella fundadora de la genealogia (I.1 i I.2), i els individus IV.14, IV.17 i IV.18 són fills de III.7. Es va fer una anàlisi de lligament paramètric multipuntual considerant una herència autosòmica dominant amb p=90% i f=10%, i es va obtenir un únic valor de LOD score per sobre de 1,5 a la regió cromosòmica 14q24-32. Uns altres 4 loci van presentar Z>1: 1p31, 3p25, 12p12 i 15qtel (figura 3a). En paral·lel, es va dur a terme una anàlisi de lligament no paramètrica (sense considerar un model d’herència concret) de tipus exponencial i s’obtingué un valor màxim de LOD score a la mateixa regió del cromosoma 14 (Z= 1,62, p= 0,003) (figura 3b). 102 Capítol 1 – Annex a l’article 1 RESULTATS Definició i acotament de la regió crítica A continuació es va aprofundir en l’anàlisi dels 5 loci que presentaven LOD scores superiors a 1 genotipant nous marcadors de tipus mirosatèl·lit i afegint 14 individus addicionals de la família, tots ells sans. El LOD score obtingut en aquestes noves anàlisis va davallar respecte a l’anàlisi inicial a quatre de les regions potencialment candidates a contenir el gen responsable a b Figura 3. Anàlisi de lligament multipuntual paramètric (a) i no paramètric (b) entre el fenotip MA i/o MO i 400 marcadors microsatèl·lits de la col·lecció de mitjana densitat ABI PRISM Linkage Mapping Set v2.5 MD10 Panel d’Applied Biosystems (Foster City, CA). Les fletxes indiquen el punt amb el valor màxim de LOD score a la regió cromosòmica 14q24.3-34. de la malaltia: 1p31, 3p25, 12p12 i 15qtel. Només en el cas de la regió 14q24-32 es va obtenir un LOD score màxim superior al de l’anàlisi inicial, amb Zmax = 2,12 a θ = 0,00 pel marcador D14S67, i valors positius pels marcadors més propers (taula 2). Això va confirmar aquesta regió genòmica com la de major probabilitat de contenir el gen de risc per a la malaltia en aquesta família. 103 RESULTATS Lligament genètic Taula 2. Valors de LOD de 2 punts calculats amb el programa MLINK, considerant f=10 i p=90 i tots els individus genotipats excepte el grup exclòs (25 individus). Posició Marcador cM Mb D14S261 D14S283 D14S275 D14S70 D14S288 D14S276 D14S63 D14S258 D14S74 D14S59 D14S1037 D14S67 D14S68 D14S256 D14S1044 D14S280 D14S65 D14S985 D14S292 6,46 13,89 28,01 40,11 47,51 56,36 69,18 76,28 87,36 87,36 92,69 95,89 95,89 96,42 99,88 105,00 117,30 126,61 134,30 19,91 21,76 25,77 33,53 43,17 54,75 63,62 69,55 77,63 77,14 84,27 87,46 87,70 88,28 89,04 91,15 96,59 100,27 103,67 LOD score a θ= 0,00 0,01 0,05 0,10 0,20 0,30 0,40 Zmax θmax 1,368 -0,321 -1,290 -1,394 -0,344 -1,851 -1,672 -1,168 -0,179 0,497 -0,137 2,122 1,477 0,710 1,410 0,468 -2,168 -0,353 -1,540 1,330 -0,230 -1,072 -1,261 -0,224 -1,670 -1,483 -1,065 -0,173 0,599 -0,127 2,088 1,482 0,675 1,389 0,483 -2,033 -0,350 -1,412 1,177 -0,014 -0,643 -0,878 0,076 -1,158 -0,959 -0,776 -0,147 0,822 -0,089 1,929 1,456 0,538 1,281 0,506 -1,596 -0,326 -1,044 0,990 0,098 -0,377 -0,580 0,251 -0,768 -0,570 -0,550 -0,112 0,906 -0,048 1,691 1,352 0,379 1,111 0,482 -1,165 -0,275 -0,747 0,635 0,121 -0,109 -0,264 0,322 -0,339 -0,169 -0,281 -0,050 0,807 0,008 1,150 1,015 0,149 0,716 0,364 -0,552 -0,159 -0,375 0,324 0,046 -0,009 -0,125 0,235 -0,129 -0,007 -0,130 -0,008 0,529 0,028 0,621 0,609 0,054 0,340 0,230 -0,206 -0,066 -0,155 0,098 -0,020 0,006 -0,056 0,106 -0,031 0,035 -0,041 0,006 0,198 0,020 0,216 0,230 0,020 0,090 0,108 -0,042 -0,011 -0,035 1,368 0,121 0,006 -0,056 0,322 -0,031 0,035 -0,041 0,006 0,906 0,028 2,122 1,477 0,710 1,410 0,506 -0,042 -0,011 -0,035 0,00 0,20 0,40 0,40 0,20 0,40 0,40 0,40 0,40 0,10 0,30 0,00 0,00 0,00 0,00 0,05 0,40 0,40 0,40 El LOD score multipuntual per aquesta regió enriquida en individus i marcadors va assolir un valor màxim Zmax de 2,5, sobre el marcador D14S67 (figura 4). Figura 4. Anàlisi de lligament paramètric entre el fenotip MA i/o MO i els 12 marcadors de la regió 14q2432. Els LOD score s’han calculat amb el programa LINKMAP assumint f=10 i p=90. La construcció dels haplotips de la regió 14q24-32 (figura 1) revelen que l’haplotip que segrega amb la migranya en aquesta família té una extensió de 19,45 Mb. La regió crítica està 104 Capítol 1 – Annex a l’article 1 RESULTATS delimitada a l’extrem proximal per una recombinació entre els marcadors D14S59 i D14S1037 en l’individu afectat de MO, IV.24 i per una recombinació entre els marcadors D14S280 i D14S65 en els individus III.10, IV.3 i IV.10, tots ells amb fenotip MA, a la part distal. Tots els individus afectats de la família són portadors de l’haplotip de risc a excepció dels individus III.3 i la seva filla IV.5, que tenen MO. Entre els individus sans hi ha dos individus portadors de l’haplotip de risc, el III.6 que és portador obligat, i l’individu IV.21. El “grup exclòs” (l’individu III.7 i els seus fills) s’ha genotipat en l’última fase del estudi per estudiar els haplotips presents, però no s’ha tingut en compte per a les anàlisis de lligament. El gen l’SLC24A4, que codifica un intercanviador de calci i sodi dependent de potassi, i que està situat a l’interval crític compartit per les dues famílies (aquesta i la de l’article 1), es va escollir com el millor gen candidat funcional d’entre els candidats posicionals. L’anàlisi mutacional de les regions codificants i intròniques flanquejants del gen SLC24A4 a l’individu III.10, portador de l’haplotip que cosegrega amb la malaltia, no va revelar cap variant potencialment patogènica. 105 CAPÍTOL 2 GENETIC 27 SPANISH HEMIPLEGIC MIGRAINE, BASILAR-TYPE CHILDHOOD PERIODIC SYNDROMES. ANALYSIS OF PATIENTS WITH MIGRAINE AND E Cuenca-León, R Corominas, N Fernàndez-Castillo, V Volpini, M del Toro, M Roig, A Macaya, B Cormand ARTICLE 2 CEPHALALGIA: ACCEPTAT Capítol 2 – Article 2 RESULTATS RESUM Anàlis genètica de 27 pacients espanyols amb migranya hemiplègica, migranya de tipus basilar i síndromes periòdiques de la infància. La migranya hemiplègica familiar (FHM) és un tipus rar de migranya amb aura. Fins ara s’han descrit mutacions en tres gens diferents en pacients amb FHM: CACNA1A (subunitat α1A del canal de calci neuronal de tipus P/Q, FHM1), ATP1A2 (ATPasa transportadora de Na+ i Ca2+, FHM2) i SCN1A (subunitat α1A del canal de Na+ neuronal de tipus I, FHM3). Hem analitzat aquests gens en 27 pacients espanyols amb migranya hemiplègica (HM), migranya de tipus basilar (BM) o síndromes periòdiques de la infància (CPS). Tot i que encara no hem demostrat la seva patogenicitat a nivell funcional, s’han identificat dues noves variants en individus amb HM, p.Val581Met i p.Tyr1245Cys, i un canvi prèviament descrit, p.Cys1534Ser, en el gen CACNA1A. Cal destacar que la variant p.Tyr1245Cys s’ha identificat en un pacient amb un fenotip canviant en funció de l’edat que comença com a torticoli paroxístic benigne del lactant (BPT) i evoluciona a vertigen paroxístic benigne de l’adolescència (BPV) per acabar finalment en HM. Aquest és el primer exemple en què es descriu una alteració genètica en un cas de CPS. El fet que el cribratge molecular permeti identificar mutacions potencialment patogèniques només en un 15% dels pacients amb HM constata l’existència d’heterogeneïtat genètica a les formes de migranya presumiblement monogèniques. 109 Capítol 2- Article 2 RESULTATS Genetic analysis of 27 Spanish patients with hemiplegic migraine, basilar-type migraine and childhood periodic syndromes E Cuenca-León1, R Corominas1, N Fernàndez-Castillo2,3, V Volpini4, M del Toro1, M Roig1, A Macaya1, B Cormand2,3,5 1 Grup de Recerca en Neurologia Infantil i Psiquiatria Genètica, Hospital Universitari Vall d’Hebron, Barcelona, Catalonia, Spain 2 Departament de Genètica, Universitat de Barcelona, Barcelona, Catalonia, Spain 3 Centro de Investigación Biomédica en Red de Enfermedades Raras (CIBERER), Barcelona, Catalonia, Spain 4 Center for Molecular Genetic Diagnosis - IDIBELL, l’Hospitalet de Llobregat, Barcelona, Catalonia, Spain 5 Institut de Biomedicina de la Universitat de Barcelona (IBUB), Catalonia, Spain Correspondence should be addressed to: Bru Cormand, PhD Associate Profesor of Genetics Departament de Genètica, Facultat de Biologia, Universitat de Barcelona Av. Diagonal 645, edifici annex, 3ª planta 08028 Barcelona, SPAIN Phone: 34-934021013 Fax: 34-934034420 email: [email protected] 111 RESULTATS Anàlisi mutacional ABSTRACT Familial Hemiplegic Migraine (FHM) is a rare type of migraine with aura. Mutations in three genes have been described in FHM patients: CACNA1A (FHM1), ATP1A2 (FHM2) and SCN1A (FHM3). We screened 27 Spanish patients with hemiplegic migraine (HM), basilar-type migraine (BM), or childhood periodic syndromes (CPS) for mutations in these three genes. We identified two novel CACNA1A variants, p.Val581Met and p.Tyr1245Cys, and a previously annotated change, p.Cys1534Ser, in individuals with HM, although they have not been proven to be pathogenic as yet. Interestingly, p.Tyr1245Cys was detected in a patient displaying a changing, agespecific phenotype that began as benign paroxysmal torticollis of infancy (BPT), evolving into benign paroxysmal vertigo of childhood (BPV) and later becoming HM. This is the first instance where a specific gene alteration is described in a subject affected with CPS. The fact that the molecular screen identified potential pathogenic mutations in less than 15% of our HM patients further stresses the genetic heterogeneity underlying the presumably monogenic forms of migraine. Keywords: mutation analysis, CACNA1A, hemiplegic migraine, childhood periodic syndromes, basilar-type migraine 112 RESULTATS Capítol 2- Article 2 INTRODUCTION Familial Hemiplegic Migraine (FHM) [MIM# 141599] and Sporadic Hemiplegic Migraine (SHM) are rare types of migraine with aura. The deciphering of the first two molecular defects underlying the condition has led to its being classified into subtypes. In FHM1, missense mutations in the CACNA1A gene on chromosome 19p13.13, encoding the α subunit of the neuronal P/Q-type calcium channel (CACNA1A), were first reported in five unrelated FHM families (1). To date, at least 18 different CACNA1A missense mutations have been reported in FHM families (2). Most of these mutations recur very infrequently, with the exception of p.Thr666Met, found in 20 families worldwide and p.Arg583Gln, reported in six families (3). About half of the FHM families show additional signs of progressive cerebellar ataxia (4) or, less frequently, epileptic seizures (5), cognitive dysfunction (6) or migraine coma (7). Mutations in the CACNA1A gene also cause episodic ataxia type 2 (EA-2) [MIM#108500], and spinocerebellar ataxia type 6 (SCA6) [MIM#183086]. Most of the EA-2-related CACNA1A mutations are nonsense, splice site, small deletions or insertions which disrupt the open reading frame and result in a truncated protein, while SCA6 is usually caused by expansion of an unstable CAG repeat on the C-terminal region of the protein (8). However, missense mutations have also been identified in SCA6 and EA-2. Conversely, FHM2 is linked to mutations in the ATP1A2 gene on chromosome 1q23.2. More than 30 FHM2 missense mutations have been identified in this gene so far (2, 3, 9); but also in other phenotypes including alternating hemiplegia of childhood (10), migraine with aura (MA), migraine without aura (MO) (11) and basilar-type migraine (BM) (12). Recently, a third gene has been associated with FHM. The same mutation, p.Gln1489Lys, was identified in three independent FHM families, now classified as 113 RESULTATS Anàlisi mutacional FHM3, in the SCN1A gene, which encodes the α subunit of the neuronal voltage-gated type I sodium channel (13). Some clinical syndromes that are precursors of migraine in young patients, including cyclical vomiting (CV), abdominal migraine and benign paroxysmal vertigo in childhood (BPV), have recently been reclassified by the IHS as Childhood Periodic Syndromes (CPS). Although these syndromes have been known for decades (14, 15), their suggested relationship with migraine remains a matter of debate, as is the case for another possible subtype of migraine precursor, benign paroxysmal torticollis of infancy (BPT). In addition, there is very little genetic evidence to date linking familial migraine and CPS (16). Here we report the clinical manifestations of a series of 27 Spanish patients diagnosed with hemiplegic migraine (HM), BM or CPS and the results of a molecular analysis of the three known FHM genes that allowed the identification of three CACNA1A potential pathogenic mutations. 114 Capítol 2- Article 2 RESULTATS MATERIALS AND METHODS Subjects This study includes 27 unrelated Spanish patients referred to Vall d’Hebron University Hospital, Barcelona, during the period 1999-2004 with diagnoses of HM, BM or CPS, the migraine phenotypes previously associated with mutations in the CACNA1A, ATP1A2 and SCN1A genes. CPS presented as BPV or BPT (the latter being considered as a possible CPS by virtue of its present classification and encoded A1.3.5 in the International Classification of Headache Disorders (ICHD-II) appendix (17)). Twenty-two patients were directly interviewed and examined by one of the authors (AM) and information about the remaining 5 cases was obtained from referring physicians and completed through telephone interview. Positive family history in first or second degree relatives was elicited from the patients or from their parents in case of paediatric patients. In kindreds with positive family history, at least one affected relative was directly interviewed; the diagnosis of FHM was established upon the presence of two or more cases of migraine with aura including motor weakness. The diagnosis of CPS was based on the presence of recurrent torticollis, vertigo, vomiting and/or behavioural changes in neurologically and audiologically intact children, and was later confirmed in all cases following the guidelines given by the IHS in the ICHD-II (17). The clinical diagnosis of migraine types was initially established in accordance with the ICHD-I criteria (18) and later confirmed according to ICHD-II. For genetic studies we recruited 64 unrelated control individuals from the Blood Extraction Unit of the Vall d’Hebron University Hospital. They were Spanish, Caucasoid and lacked any history of recurrent or disabling headache, as did their first-degree relatives. Samples Blood venous samples were obtained from 27 probands and from 64 unrelated nonmigraineurs. Genomic DNA was isolated using the QIAamp DNA Blood Maxi Kit 115 RESULTATS Anàlisi mutacional (QIAGEN, Hilden, GE) after each subject had provided written informed consent for DNA analysis and the local ethics committee had approved the study, which follows the guidelines of the Helsinki Declaration. DNA and Mutation analysis The 47 exons of the CACNA1A gene, the 23 exons of the ATP1A2 gene and exon 23 of the SCN1A gene and their corresponding exon/intron junctions, including splice sites and branch points, were PCR-amplified and sequenced in 42, 16 and 1 independent PCR products, respectively. The primers were designed using Primer3 software (frodo.wi.mit.edu/cgi-bin/primer3/primer3_www.cgi) (19). Primer sequences are available as supplementary material (Tables S1 and S2). The details of the PCR procedures are available from the authors upon request. The PCR products were purified and sequenced (ABI PRISM 3700 DNA analyzer, Applied Biosystems, Foster City, CA). The identified changes were confirmed by digestion of the corresponding PCR product with the appropriate restriction enzyme: NspI (p.Val581Met), ItaI (p.Tyr1245Cys) and HpyCH4V (p.Cys1534Ser). Sixty-four unrelated healthy Spanish individuals were screened for the presence of the gene variants identified in the patients by either restriction enzyme cleavage of PCR products or Single-Strand Conformation Polymorphism (SSCP) analysis (20) The potential disease-causing mutations and the polymorphic variants identified in the CACNA1A gene were named according to HGVS guidelines (www.hgvs.org), using RefSeq accession number NM_023035 as a cDNA reference sequence, with nucleotide 283, the A of the ATG initiation codon, corresponding to +1, and NP_075461 as the protein reference sequence. Both sequences correspond to the CACNA1A transcript variant 2. The ATP1A2 reference sequences were NM_000702 for the cDNA and NP_000693 for the protein. 116 Capítol 2- Article 2 RESULTATS RESULTS Clinical data The main clinical features of the 27 patients are shown in Table 1. Episodes of HM were documented in 21 patients, irrespective of the mode of onset. Age at onset ranges from 15 days to 2 months in BPT (n=4), from 11 months to 6 years in BPV (n=7) and from 8 to 18 years in HM (n=21). In the single case presenting as BM, onset was in childhood. Eight patients presented as CPS. The main symptom of CPS, torticollis or vertigo, was often associated with pallor, hypotonia, irritability, anxiety, vomiting or crying during the attacks. Of note, three of the four patients that had their onset in early infancy with episodes of BPT, subsequently developed BPV and one of them has finally evolved into the HM phenotype. The fourth BPT patient developed HM at age 8 years. Among patients who had their onset in childhood with episodes of BPV (n=4), one has developed HM, one BM and two continue to display BPV at the ages of five and six years, the latter with accompanying headache. All BPV patients had normal EEG and audiometric testing; clinical screening of vestibular function in school-aged children was also normal. The remaining 19 patients presented with more typical “adult” phenotypes, including FHM (n=7), SHM (n=7), MA (n=4) and BM (n=1). All patients with MA went on to develop typical HM attacks. No patient had concomitant ataxia. Interictally, all 27 patients had normal neurological examinations and all had normal brain MRI. Overall, family history of migraine was present in 23/27 cases, including 18/21 of those developing HM, 2/2 with BM and 3/4 of the younger patients with CPS that have not developed migraine. In 12 families, the affected relatives fulfilled the ICHD-II criteria (17) for FHM. 117 RESULTATS Anàlisi mutacional No other signs suggestive of neuronal channelopathy were noted, except for infantile convulsions that were reported in case 6 and in one of his relatives and epilepsy in three other unrelated subjects belonging to the families of cases 14, 16 and 27. Genetic analysis Two new and one previously cited gene variants were identified in three unrelated individuals (cases 1, 9 and 27) after extensive sequencing of the CACNA1A gene in the 27 probands (Table 2). In the remaining 24 patients not bearing CACNA1A alterations, a sequence analysis of the ATP1A2 gene and exon 23 of the SCN1A gene did not reveal any putative pathogenic change. In a patient presenting the age-specific sequential phenotypes of BPT, BPV and FHM (case 1) a change from A to G at cDNA nucleotide 3734 in exon 22 was identified, prompting the new gene variant p.Tyr1245Cys, located at domain III, segment 1 (DIII-S1) of Cav2.1. A patient with pure FHM (case 9) was found to harbour the p.Val581Met variant, encoded in exon 13. This was brought about by a G to A substitution at cDNA nucleotide 1741 leading to the substitution of a methionine for a highly conserved valine located at domain II, segment 4 (DII-S4) of the protein. Finally, in another FHM patient (case 27), a change from G to C at cDNA nucleotide 4601 in exon 29 produced the p.Cys1534Ser variant which lies in the intracellular loop between domains DIII and DIV (Fig. 1 and Table 2) . The pedigrees of patients 1, 9 and 27 are shown in Fig. 2. The presence of these gene variants was confirmed by a restriction analysis of the corresponding PCR products and they were not present in 64 unrelated Spanish non-migraineurs. The residues that were replaced are highly conserved in evolution in paralogous human α1 subunits of Cav2 and Cav1 channels (CACNA1A, B, E, D, F, C and S) as well as in orthologous CACNA1A subunits of cattle (Bos taurus), mouse (Mus musculus), rat (Rattus norvegicus), rabbit (Oryctolagus cuniculus), zebrafish 118 Capítol 2- Article 2 RESULTATS (Danio rerio) and fruit fly (Drosophila melanogaster) (Fig. 3). The conservation is only lost for residue p.Tyr1245 in the human CACNA1D, F, C and S protein (present in Cav1 channels), but not in CACNA1B and E (Cav2 channels), evolutionary and functionally closer to CACNA1A (21). No potential pathogenic mutations were found in the coding region of the CACNA1A gene in the remaining 24 probands, some of which bear polymorphic variants with non-apparent pathogenic effect (Table S3). To our knowledge, four of these changes, c.400-28C>T (intron 2), c.5253-101C>T (intron 34), c.5944-52C>T (intron 40) and c.6840G>A or p.Pro2280Pro (exon 47) are described here for the first time, the latter being located in the coding region of the CACNA1A isoform 2. All these changes were found in several patients and also in a subset of 64 Spanish healthy controls in which minor allele frequency (MAF) ranged from 0.008 to 0.211. We also found three previously described non-synonymous variants located in exons 19 (rs16022C>G or p.Asp918Glu and rs16023T>A or p.Val993Glu) and 20 (rs16027A>G or p.Ser1105Gly), which were present in several patients and in the general population (Table S3). Three previously described polymorphic variants (rs16041C>T in intron 35, rs16006A>G in exon 6 and c.579G>A in exon 4) were found only in one patient each. Their population frequencies had been studied previously by other authors in several panels of individuals and were found to range between 0.02 and 0.04. One of them, c.579G>A (p.Thr193Thr), was not found in a screening of 64 Spanish non-migraineurs performed by us, although it was present in a set of 50 randomly collected Dutch individuals with a MAF of 0.02 (1). The 24 individuals not bearing potential pathogenic CACNA1A mutations did not show ATP1A2 changes either. Yet, several polymorphic variants were once again identified, including two novel changes in the 5’-UTR region of the gene (c.1-48C>G and c.1-42G>C), both present only in patient 11, and two previously described polymorphic variants (c.749-43G>C in intron 7 and rs2070701G>A in the 3’-UTR 119 RESULTATS Anàlisi mutacional region), also found in only one patient each (Table S3). The presence of the p.Gln1489Lys SCNA1A missense mutation was ruled out in these 24 individuals. DISCUSSION We report two novel and one previously cited potential pathogenic mutations in the CACNA1A gene in a set of 27 unrelated, predominantly familial, Spanish cases with different migraine variants (HM, BM, CPS). To our knowledge, this is the first molecular analysis of the CACNA1A, ATP1A2 and SCN1A genes to have been conducted in Spanish patients. Molecular genetics of HM In our series, the ratio of three cases bearing CACNA1A changes out of 11 pure FHM cases (27.3 %) is roughly in line with figures reported elsewhere (e.g. 4/12 (22) or 6/42 (3)), but stands in contrast to the widely accepted notion that mutations in the CACNA1A gene account for more than half of FHM cases, reviewed in (2). However, a more detailed review of the literature reveals that these high percentages were only recorded when mutational screenings included FHM families selected on the basis of their putative linkage to the CACNA1A locus on 19p13 or on that of the occurrence of concomitant cerebellar ataxia. Thus, 15 mutations were found in 16 FHM families with cerebellar signs and positive linkage to CACNA1A (22) and 5 out of 6 FHM families with previous positive linkage, two of them with cerebellar signs (1). The proportion of patients with CACNA1A mutations is much lower in the case of SHM, and always below 5% in the absence of cerebellar signs (1, 23-25). In our study we did not find any CACNA1A mutation among the 10 SHM cases 120 Capítol 2- Article 2 RESULTATS without cerebellar signs, despite the fact that seven of them displayed familial history of (non-hemiplegic) migraine. It is of note that no ATP1A2 changes were found in our series. This is in contrast with previous studies that report percentages of 42% (11/26) (26), 17% (1/6) (27) and 7% (3/42) (3) for ATP1A2 mutations in FHM patients without mutations in the CACNA1A gene. However, no ATP1A2 mutations were found in a study including 19 FHM and 7 BM patients (25). Mutations in SCN1A, the only other gene linked to FHM and involved in several forms of epilepsy, would appear to be as a rather unusual cause of FHM. Indeed, more than 160 mutations have been identified in SCN1A (HGMD, www.hgmd.cf.ac.uk) (28) compared to just one in FHM (13). Finally, at least one other FHM locus has been mapped to 1q31, but the underlying gene awaits identification (29). The fact that only 3 CACNA1A potential pathogenic mutations have been identified in 27 patients with HM, BM or CPS after an exhaustive screening of CACNA1A and ATP1A2 may be explained by the high level of genetic heterogeneity in this group of paroxysmal conditions. Nevertheless, it is also possible that a low number of mutations have remained unidentified in the genes studied, including changes in introns or in the regulatory regions, or gross alterations that may be undetectable by PCR. Childhood Periodic Syndromes and CACNA1A In this report we describe eight patients that presented with a CPS phenotype in infancy or childhood. The various CPS phenotypes have generally been considered paediatric equivalents of migraine and three of them, BPV, CV and abdominal migraine, are recognized by the IHS as migraine equivalents in 121 RESULTATS Anàlisi mutacional infancy or early childhood. A fourth phenotype, BPT, awaits validation as CPS or migraine precursor. BPT might very well be the earliest manifestation of migraine in life. In fact, our patient 1 presented with torticollis episodes during the neonatal period, similar to two cases reported elsewhere (30, 31). Our patient was found to bear the p.Tyr1245Cys variant in the CACNA1A gene and his clinical course reflects the changing, age-specific phenotypes associated with CACNA1A dysfunction, i.e. BPT, BPV and FHM. This sequence in the leading clinical manifestations, which may at times overlap, was seen in three of our four BPT patients and has also been suggested by other authors (32-35). Our results provide evidence of a common genetic background for some forms of CPS and FHM. A previous study (16) reported a patient with BPT featuring interictal ataxia and who belonged to one kindred with FHM and ataxia linked to a CACNA1A mutation. However, the authors did not disclose the genotype of the probandus. BPV, in turn, is the most common cause of childhood vertigo without ear disease or hearing loss (36). Classic BPV begins between 1 and 4 years of age and further evolution towards MA is observed in more than 50% of cases (37, 38). Among our seven BPV cases, three have developed classical migraine phenotypes by age 10: FHM in two cases and BM in one. The remaining four patients are younger than 7 years; two of them complain of recurrent headaches. Description of identified CACNA1A missense variants Several findings point to a causative role of the three missense changes identified 122 in the CACNA1A gene, p.Val581Met, p.Tyr1245Cys and Capítol 2- Article 2 RESULTATS p.Cys1534Ser, although the eventual demonstration of their pathogenicity in FHM will require functional studies. The p.Val581Met variant (patient 9) involves a residue located within the transmembrane S4 segment of the DII domain (DII-S4), and the change is predicted to shorten a α helix, as determined by the PSIPRED software (www.psipred.net) (39). This segment probably represents the voltage sensor of the channel, in which most mutations have been described. All the mutations reported to date in S4 segments, except for the mutation reported here, are substitutions of a conserved arginine (192, 195, 583, 1347, 1661, 1664 and 1667) and the majority of them have been associated with the combination of hemiplegic migraine and episodic ataxia or cerebellar signs. The p.Tyr1245Cys variant (patient 1) affects the transmembrane DIII-S1 segment. No other missense/nonsense changes have previously been described in the S1 segment of any domain of the α1A subunit of the CaV2.1 channel in any patient with FHM. This may argue against its involvement in the disease, although the total number of FHM mutations that have been described in the gene so far (around 20) is still small. The third gene variant identified, p.Cys1534Ser (patient 27), was described in a previous report in three relatives with FHM, two of them with concomitant episodic ataxia (40). However, the presence of this change in the general population was not assessed, and its putative structural/functional relevance not discussed. Prediction of the protein secondary structure indicates that the amino acid change produces a shortening of a α helix which might have functional consequences for the channel. The mutation involves a residue located in the intracellular loop between domains DIII and DIV, where no other 123 RESULTATS Anàlisi mutacional mutations have been described in FHM to our knowledge. Interestingly, the CACNA1A protein is structurally very similar to SCN1A, and the only FHM mutation (p.Gln1489Lys) described so far in the latter is, like Cys1534Ser, also located in the DIII-DIV linker. Other evidence supports the relation of these three missense variants with the disease phenotype: First, the residues involved are highly conserved in evolution, both at the intraspecific (human CACNA1A, B, C and E subunits) and interspecific levels (CACNA1A subunit of human, cattle, mouse, rat, rabbit, zebrafish and fruit fly), indicating functional/structural relevance (Fig. 3). Second, we did not detect the presence of these variants in a screening of 64 healthy Spanish individuals in which migraine had been specifically excluded, and the changes are not present in the public SNP databases, indicating that they are not polymorphic variants. And third, no other molecular alterations were identified within the gene after the analysis of the whole coding region and the exon-intron boundaries, including splice sites and branch points. Unfortunately, family members were unavailable for cosegregation analysis between the disease phenotype and the identified variants, which may had provided additional clues about their putative causative role. Conclusions Mutational analysis of ion channel genes is often expensive and timeconsuming, but it is conceivable that some clinical clues might help guiding molecular diagnosis in HM. Thus, episodic or permanent cerebellar ataxia or trauma-induced episodes should prompt investigation of CACNA1A mutations (FHM1). Alternating hemiplegia or BM may suggest a defect in ATP1A2 124 Capítol 2- Article 2 RESULTATS (FHM2). Concomitant epilepsy suggests mutations in SCN1A (FHM3), although absence epilepsy has been described in FHM1 and benign familial infantile convulsions in FHM2. On the basis of the present results reported here and previous molecular genetic studies, we hypothesize that, while the list of FHM-causative genes is expected to grow, a substantial number of cases may follow more complex patterns of inheritance, similar in this respect to other migraine variants. ACKNOWLEDGEMENTS The authors wish to thank all the patients and family members for their cooperation and J Artigas, M Pineda, A Rodríguez, and M Galván for patient referral. JM Fernández is acknowledged for helpful suggestions in the preparation of the manuscript and M Ribasés for technical assistance. This study was supported by the Spanish Ministry of Education and Science (SAF-2000/197 and SAF-2003/04704), Red Española de Ataxias, Fondo de Investigación Sanitaria, Spain (G03/056 and PI052129), Instituto de Salud Carlos III, Spain (PI061073, PI050996) and AGAUR (2005SGR00848). E.C-L. was a recipient of a FPI scholarship of the Ministerio de Ciencia y Tecnología, Spain. R.C. was funded by the Institut de Recerca Vall d’Hebron. 125 RESULTATS Anàlisi mutacional REFERENCES 1 Ophoff RA, Terwindt GM, Vergouwe MN, van Eijk R, Oefner PJ, Hoffman SM, et al. Familial hemiplegic migraine and episodic ataxia type-2 are caused by mutations in the Ca2+ channel gene CACNL1A4. Cell 1996;87:543-52. 2 Pietrobon D. Familial hemiplegic migraine. Neurotherapeutics 2007;4:274-84. 3 Thomsen LL, Kirchmann M, Bjornsson A, Stefansson H, Jensen RM, Fasquel AC, et al. The genetic spectrum of a population-based sample of familial hemiplegic migraine. Brain 2007;130:346-56. 4 Ducros A, Denier C, Joutel A, Vahedi K, Michel A, Darcel F, et al. Recurrence of the T666M calcium channel CACNA1A gene mutation in familial hemiplegic migraine with progressive cerebellar ataxia. Am J Hum Genet 1999;64:89-98. 5 Kors EE, Melberg A, Vanmolkot KR, Kumlien E, Haan J, Raininko R, et al. Childhood epilepsy, familial hemiplegic migraine, cerebellar ataxia, and a new CACNA1A mutation. Neurology 2004;63:1136-7. 6 Kors EE, Haan J, Giffin NJ, Pazdera L, Schnittger C, Lennox GG, et al. Expanding the phenotypic spectrum of the CACNA1A gene T666M mutation: a description of 5 families with familial hemiplegic migraine. Arch Neurol 2003;60:684-8. 7 Vahedi K, Denier C, Ducros A, Bousson V, Levy C, Chabriat H, et al. CACNA1A gene de novo mutation causing hemiplegic migraine, coma, and cerebellar atrophy. Neurology 2000;55:1040-2. 8 Jodice C, Mantuano E, Veneziano L, Trettel F, Sabbadini G, Calandriello L, et al. Episodic ataxia type 2 (EA2) and spinocerebellar ataxia type 6 (SCA6) due to CAG repeat expansion in the CACNA1A gene on chromosome 19p. Hum Mol Genet 1997;6:1973-8. 9 Vanmolkot KR, Stroink H, Koenderink JB, Kors EE, van den Heuvel JJ, van den Boogerd EH, et al. Severe episodic neurological deficits and permanent mental 126 Capítol 2- Article 2 RESULTATS retardation in a child with a novel FHM2 ATP1A2 mutation. Ann Neurol 2006;59:310-4. 10 Swoboda KJ, Kanavakis E, Xaidara A, Johnson JE, Leppert MF, SchlesingerMassart MB, et al. Alternating hemiplegia of childhood or familial hemiplegic migraine? A novel ATP1A2 mutation. Ann Neurol 2004;55:884-7. 11 Todt U, Dichgans M, Jurkat-Rott K, Heinze A, Zifarelli G, Koenderink JB, et al. Rare missense variants in ATP1A2 in families with clustering of common forms of migraine. Hum Mutat 2005;26:315-21. 12 Ambrosini A, D'Onofrio M, Grieco GS, Di Mambro A, Montagna G, Fortini D, et al. Familial basilar migraine associated with a new mutation in the ATP1A2 gene. Neurology 2005;65:1826-8. 13 Dichgans M, Freilinger T, Eckstein G, Babini E, Lorenz-Depiereux B, Biskup S, et al. Mutation in the neuronal voltage-gated sodium channel SCN1A in familial hemiplegic migraine. Lancet 2005;366:371-7. 14 Basser. Benign paroxysmal vertigo of childhood. Brain. 1964;87:141-52. 15 Fenichel. Migraine as a cause of benign paroxysmal vertigo of childhood. J Pediatr 1967;71:114-5. 16 Giffin NJ, Benton S, Goadsby PJ. Benign paroxysmal torticollis of infancy: four new cases and linkage to CACNA1A mutation. Dev Med Child Neurol 2002;44:490-3. 17 The International Classification of Headache Disorders: 2nd edition. Cephalalgia 2004;24 Suppl 1:9-160. 18 Classification and diagnostic criteria for headache disorders, cranial neuralgias and facial pain. Headache Classification Committee of the International Headache Society. Cephalalgia 1988;8 Suppl 7:1-96. 19 Rozen S, Skaletsky H. Primer3 on the WWW for general users and for biologist programmers. Methods Mol Biol 2000;132:365-86. 127 RESULTATS 20 Anàlisi mutacional Cormand B, Grinberg D, Gort L, Fiumara A, Barone R, Vilageliu L, Chabas A. Two new mild homozygous mutations in Gaucher disease patients: clinical signs and biochemical analyses. Am J Med Genet 1997;70:437-43. 21 Jurkat-Rott K, Lehmann-Horn F. The impact of splice isoforms on voltage-gated calcium channel alpha1 subunits. J Physiol 2004;554:609-19. 22 Ducros A, Denier C, Joutel A, Cecillon M, Lescoat C, Vahedi K, et al. The clinical spectrum of familial hemiplegic migraine associated with mutations in a neuronal calcium channel. N Engl J Med 2001;345:17-24. 23 Carrera P, Piatti M, Stenirri S, Grimaldi LM, Marchioni E, Curcio M, et al. Genetic heterogeneity in Italian families with familial hemiplegic migraine. Neurology 1999;53:26-33. 24 Terwindt G, Kors E, Haan J, Vermeulen F, Van den Maagdenberg A, Frants R, Ferrari M. Mutation analysis of the CACNA1A calcium channel subunit gene in 27 patients with sporadic hemiplegic migraine. Arch Neurol 2002;59:1016-8. 25 Jen JC, Kim GW, Dudding KA, Baloh RW. No mutations in CACNA1A and ATP1A2 in probands with common types of migraine. Arch Neurol 2004;61:926-8. 26 Riant F, De Fusco M, Aridon P, Ducros A, Ploton C, Marchelli F, et al. ATP1A2 mutations in 11 families with familial hemiplegic migraine. Hum Mutat 2005;26:281. 27 Pierelli F, Grieco GS, Pauri F, Pirro C, Fiermonte G, Ambrosini A, et al. A novel ATP1A2 mutation in a family with FHM type II. Cephalalgia 2006;26:324-8. 28 Mulley JC, Scheffer IE, Petrou S, Dibbens LM, Berkovic SF, Harkin LA. SCN1A mutations and epilepsy. Hum Mutat 2005;25:535-42. 29 Lea RA, Shepherd AG, Curtain RP, Nyholt DR, Quinlan S, Brimage PJ, Griffiths LR. A typical migraine susceptibility region localizes to chromosome 1q31. Neurogenetics 2002;4:17-22. 30 Sanner G, Bergstrom B. Benign paroxysmal torticollis in infancy. Acta Paediatr Scand 1979;68:219-23. 128 Capítol 2- Article 2 31 RESULTATS Hanukoglu A, Somekh E, Fried D. Benign paroxysmal torticollis in infancy. Clin Pediatr (Phila) 1984;23:272-4. 32 Dunn DW, Snyder CH. Benign paroxysmal vertigo of childhood. Am J Dis Child 1976;130:1099-100. 33 Deonna T, Martin D. Benign paroxysmal torticollis in infancy. Arch Dis Child 1981;56:956-9. 34 Roulet E, Deonna T. Benign paroxysmal torticollis in infancy. Dev Med Child Neurol 1988;30:409-10. 35 Drigo P, Carli G, Laverda AM. Benign paroxysmal torticollis of infancy. Brain Dev 2000;22:169-72. 36 Uneri A, Turkdogan D. Evaluation of vestibular functions in children with vertigo attacks. Arch Dis Child 2003;88:510-1. 37 Watson P, Steele JC. Paroxysmal dyseguilibrium in the migraine syndrome of childhood. Arch Otolaryngol 1974;99:177-9. 38 Lanzi G, Balottin U, Fazzi E, Mira E, Piacentino G. Benign paroxysmal vertigo in childhood: a longitudinal study. Headache 1986;26:494-7. 39 McGuffin LJ, K. B, T. JD. The PSIPRED protein structure prediction server. Bioinformatics 2000;16:404-5. 40 Dichgans M, Herzog J, Freilinger T, Wilke M, Auer DP. 1H-MRS alterations in the cerebellum of patients with familial hemiplegic migraine type 1. Neurology 2005;64:608-13. SUPPLEMANTARY MATERIAL REFERENCES 1 Ophoff RA, Terwindt GM, Vergouwe MN, van Eijk R, Oefner PJ, Hoffman SM, et al. Familial hemiplegic migraine and episodic ataxia type-2 are caused by mutations in the Ca2+ channel gene CACNL1A4. Cell 1996;87:543-52. 129 RESULTATS 2 Anàlisi mutacional Riant F, De Fusco M, Aridon P, Ducros A, Ploton C, Marchelli F, et al. ATP1A2 mutations in 11 families with familial hemiplegic migraine. Hum Mutat 2005;26:281. 130 Capítol 2- Article 2 RESULTATS FIGURE LEGENDS Figure 1. Schematic representation of the human CACNA1A gene (top), the three potential pathogenic mutations identified in this study with the corresponding sequence electropherograms (middle) and the encoded protein (bottom). Previously reported FHM mutations are indicated with numbers on the protein. cDNA and protein sequence numbering are according to HGVS guidelines (www.hgvs.org), using NM_023035 as a reference sequence for the cDNA and NP_0755461 for the protein. Figure 2. Structure of pedigrees of patients with identified gene variants. Affected individuals are denoted by solid symbols. Clinical characteristics are indicated below each individual (HM: migraine with hemiplegic aura, MA: migraine with aura; MO: migraine without aura). The CACNA1A variant carrier status is indicated below each index patient. Figure 3. Protein alignment performed with clustalW (www.ebi.ac.uk/clustalw). The human CACNA1A Val581 and Cys1534 residues are conserved in all the human calcium channel α1 subunits studied (CACNA1B, E, D, F, C and S) whereas Tyr1245 is conserved only in the evolutionary closer subunits (CACNA1B and E). All three positions are conserved in the orthologous CACNA1A proteins of several organisms. Non-conserved amino acids are indicated in grey. In brackets, the RefSeq code of each protein. ZEFI: Zebrafish, Danio rerio. DROME: Fruit fly, Drosophila melanogaster. 131 RESULTATS Figure 1 Figure 2 132 Anàlisi mutacional Capítol 2- Article 2 RESULTATS Figure 3 133 RESULTATS 134 Anàlisi mutacional Capítol 2- Article 2 RESULTATS 135 CRIBRATGE MUTACIONAL DEL GEN CACNA1A EN INDIVIDUS AMB A TÀXIA EPISÒDICA DE TIPUS 2 ANNEX A L’ARTICLE 2 Capítol 2- Annex a l’article 2 RESULTATS RESUM Cribratge mutacional del gen CACNA1A en individus amb atàxia episòdica de tipus 2 (EA2) L’atàxia episòdica de tipus 2 (EA2) és un tipus rar de canalopatia autosòmica dominant que es manifesta amb episodis de desequilibri i incoordinació. Fins ara s’han identificat més de 50 mutacions responsables del fenotip EA2 en el gen CACNA1A. Aquest treball se centra en l’anàlisi mutacional d’aquest gen en 27 pacients espanyols que manifesten EA2 d’inici tardà associada a símptomes acompanyants o a altres trastorns paroxístics. S’han identificat 4 canvis potencialment patogènics: p.Gly638Asp i p.Pro1011Ala en pacients afectats d’EA2 d’inici tardà, i p.Arg583Gln (prèviament descrita) i p.Thr501Met en dos individus que presenten EA2 i migranya amb aura (MA). La baixa proporció de mutacions identificades en el gen CACNA1A suggereix que aquest gen no és la causa principal de la EA2 i, en canvi, sembla que juga un paper important quan EA2 es presenta en combinació amb MA. 139 Capítol 2 – Annex a l’article 2 RESULTATS CRIBRATGE MUTACIONAL DEL GEN CACNA1A EN INDIVIDUS AMB ATÀXICA EPISÒDICA DE TIPUS 2 (EA2) Pacients Gràcies a la pertinença a la la Red Española de Ataxias (REA) es van poder identificar i reclutar 35 individus amb sospita d’EA2 i en funció de les proves diagnòstiques realitzades i la disponibilitat de mostres se’n van seleccionar 27 per a l’estudi mutacional del gen CACNA1A, realitzat en el marc d’aquesta Tesi. Tots els pacients, a excepció de l’individu 3 que debuta amb 16 anys, tenen la particularitat que presenten una variant d’EA2 d’inici tardà, amb els primers episodis entre els 30 i els 65 anys. La major part dels pacients presenten símptomes acompanyants durant els episodis com nistagmus o vertigen, o bé tenen associats trastorns paroxístics d’altres tipus, com migranya o més rarament epilèpsia. En alguns pacients, la sensació d’inestabilitat i el vertigen són fins i tot més prominents que la pròpia atàxia, el signe objectiu que pot documentar el metge. Així, aquests pacients es trobarien nosològicament entre el diagnòstic d’EA2 i el d’atàxia episòdica hereditària vestíbulo-cerebel·losa o EA4. Els pacients EA2 poden presentar història d’atàxia crònica progressiva o alteracions oculomotores interictals, a part dels episodis aguts d’atàxia (taula 1). En dos familiars del cas índex 1 s’ha documentat atròfia cerebel·losa (CA) mitjançant proves de neuroimatge. Individu 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 EA2, EA2, EA2, EA2, EA2, EA2, EA2, EA2 EA2 EA2 EA2, EA2, EA2 EA2 EA2, EA2, EA2, EA2, EA2, EA2 EA2 EA2 EA2, EA2, EA2 EA2, EA2 Característiques clíniques PCA, disàrtria, MA FHM vertigen vertigen, nistagmus PCA PCA PCA Taula 1. Característiques clíniques dels pacients EA2. EA2= Atàxia episòdica de tipus 2, PCA= Atàxia cerebel·losa progressiva, MA= migranya amb aura, FHM= migranya hemiplègica familiar, MO= migranya sense aura. vertigen vertigen nistagmus nistagmus nistagmus vertigen PCA migranya, epilèpsia disàrtria vertigen, torticoli paroxístic, convulsions febrils 141 RESULTATS Anàlisi mutacional Els casos esporàdics són rars, de manera que gairebé tots els individus estudiats presenten història familiar positiva d’atàxia episòdica o progressiva. En el cas del pacient 1, que prové d’una família extensa amb recurrència d’atàxia episòdica i/o progressiva, l’estudi es va fer extensiu a tots els membres disponibles de la genealogia (figura 1). I.1 2 I.2 3 1 p.Arg583Gln/+ II.1 II.2 2 1 +/+ 1 1 +/+ III.1 II.3 3 2 p.Arg583Gln/+ 2 +/+ II.4 II.5 2 2 +/+ 2 1 +/+ III.2 1 3 p.Arg583Gln/+ II.6 3 2 p.Arg583Gln/+ II.7 3 2 p.Arg583Gln/+ EA2 CA MA HM Figura 1. Representació esquemàtica de la família del pacient 1 amb la mutació identificada al gen CACNA1A. Els al·lels del marcador microsatèl·lit D19S1150 estan representats en rectangles. L’al·lel que cosegrega amb la malaltia s’indica en negre. L’individu índex II.3 és el pacient 1 de la taula 1. EA2= atàxia episòdica de tipus 2; CA= atròfia cerebel·losa; MA= migranya amb aura; HM= migranya hemiplègica. Exclusió d'atàxies espinocerebel·loses (SCAs) Com que alguns pacients presenten atàxia cerebelosa progressiva o van desenvolupar els primers símptomes de la malaltia episòdica a edats molt avançades, es va considerar oportú determinar el número de repeticions CAG en els gens responsables de les SCA de tipus 1, 2, 3, 6, 7, 8 i 12 i en el gen DRPLA. Tots els individus presentaven un nombre de repeticions dins el rang de la ‘normalitat’. Aquesta feina fou realitzada pel grup del Dr. Víctor Volpini a l’Institut de Recerca Oncològica (IRO). 142 RESULTATS Capítol 2 – Annex a l’article 2 Lligament al locus CACNA1A a la família del pacient 1 (II.3) Amb la genotipació de tots els individus disponibles de la família del pacient 1 pel marcador D19S1150, situat a l’intró 7 del gen CACNA1A, es va poder observar cosegregació del fenotip atàxic amb l’al·lel 3 del polimorfisme (figura 1). En fer càlculs de lligament genètic entre el marcador i la malaltia amb el programa MLINK (Terwilliger and Ott, 1994), es va obtenir un LOD score de dos punts de 1,87 considerant una penetració del fenotip del 90% i una taxa de fenocòpies del 5%. Les simulacions realitzades amb el programa SLINK (Ott, 1989; Weeks et al., 1990) mostren que aquest valor coincideix amb el valor màxim de LOD score esperat tenint en compte l’estructura de la família i la informativitat del marcador utilitzat. Aquesta feina es va realitzar en col·laboració amb el grup del Dr. Víctor Volpini de l’Institut de Recerca Oncològica (IRO). Anàlisi mutacional del gen CACNA1A L’anàlisi exhaustiu dels 47 exons del gen CACNA1A i de les regions intròniques flanquejants en els 27 pacients (inclòs el pacient 1) amb EA2 i altres símptomes acompanyants mitjançant seqüenciació de productes de PCR ha permès identificar quatre mutacions de canvi de sentit: dues mutacions noves (p.Thr501Met i p.Gly638Asp), una mutació ja descrita prèviament (p.Arg583Gln) i una aparent mutació (p.Pro1011Ala) curiosament descrita a les bases de dades com a polimorfisme (rs28413664), tot i que no s’ofereixen dades de freqüències al·lèliques en cap població (taula 2). Taula 2. Pacients i mutacions en el gen CACNA1A Mutació Pacient cDNA Proteïna Posició de la mutació Canvi de codó Exó Domini de la proteïna Mètode de detecció Fenotip Pacient 2 c.1502C>T p.Thr501Met ACG>ATG 11 Transmembrana S1, DII SSCP EA, FHM Pacient 1 c.1748G>A p.Arg583Gln CGA>CAA 13 Segment transmembrana S4, DII Enzim -Ban II PCA, MA Pacient 13 c.1913G>A p.Gly638Asp GGC>GAC 14 Segment extracelular S5-S6, DII Enzim -Ita I i SSCP EA Pacient 14 c.3031C>G p.Pro1011Ala CCA>GCA 19 Llaç citoplasmàtic DII-DIII Enzim +Pst I EA La numeració del cDNA i de la seqüència proteica segueix les pautes de la Human Genome Variation Society (www.hgvs.org). Per la numeració del cDNA s’ha considerat com a posició +1 el nucleòtid A del codó d’iniciació ATG (que correspon al nucleòtid 283 de la seqüència de referència NM_023035). La numeració de la proteïna s’ha realitzat en base a la seqüència de referència NP_0755461. El símbol ‘+’ o ‘-’ indica que el canvi crea o destrueix una diana per l’enzim de restricció corresponent. EA= Atàxia episòdica de tipus 2. PCA= Atàxia cerebel·losa progressiva. FHM= Migranya hemiplègica familiar. MA= Migranya amb aura. 143 RESULTATS Anàlisi mutacional Mutació p.Thr501Met: Situada a l’exó 11 del gen CACNA1A, aquesta mutació s’ha identificat en un pacient amb atàxia episòdica i migranya hemiplègica familiar. El canvi provoca una substitució de l’aminoàcid treonina, polar, per l’aminoàcid metionina, no polar, en el segment transmembrana S1 del segon domini de la proteïna, S1DII (figura 2). La posició mutada està molt conservada tan a nivell interespecífic com intraespecífic (figura 3), i el canvi no està present en 128 cromosomes d’individus no migranyosos analitzats. D19S1150 Figura 2. Representació esquemàtica del gen CACNA1A (a dalt), les quatre mutacions identificades en aquest estudi amb els corresponents electroferogrames (al mig) i la proteïna codificada (a baix). Les mutacions s’han anomenat seguint les pautes de la HGVS (www.hgvs.org), utilitzant com a referència la seqüència NM_023035 pel cDNA i la NP_0755461 per la proteïna. Mutació p.Gly638Asp: Es va detectar en un pacient amb EA2 i està situada en el llaç extracel·lular entre els segments S5 i S6 del segon domini de la proteïna, S5-S6DII (figura 2). La substitució nucleotídica produeix un canvi de l’aminoàcid polar glicina per l’àcid aspàrtic, carregat negativament. Aquesta mutació tampoc no es va trobar en 64 individus control. Aquesta posició presenta una alta homologia entre les diferents espècies analitzades i també està conservada en altres canals de calci humans (figura 3). 144 RESULTATS Capítol 2 – Annex a l’article 2 Mutació p.Pro1011Ala: Situada a l’exó 19 del gen CACNA1A, aquest canvi es va identificar en un pacient, amb episodis d’atàxia de dies de durada que es resolen espontàniament. Aquesta substitució, absent en 128 cromosomes control, provoca el canvi d’una prolina per una alanina que està en el segment citoplasmàtic d’unió entre els dominis II i III on s’han identificat regions d’interacció amb d’altres proteïnes reguladores del canal (figura 2). Aquesta posició està conservada en els gens ortòlegs de vaca, ratolí, rata i conill però no ho està a nivell intraespecífic quan es comparen els diferents canals de calci humans (figura 3). p.Thr501Met p.Arg583Gln p.Gly638Asp p.Pro1011Ala O00555|CACNA1A_HOME Q00975|CACNA1B_HOME Q15878|CACNA1E_HOME Q01668|CACNA1D_HOME O60840|CACNA1F_HOME Q13936|CACNA1C_HOME Q13698|CACNA1S_HOME WTVLSLVALNTLCVAIVHYNQ WVVLCVVALNTLCVAMVHYNQ WIVLSLVALNTACVAIVHHNQ WLVIVLVFLNTLTISSEHYNQ WAVLLLVFLNTLTIASEHHGQ WLVIFLVFLNTLTIASEHYNQ WLVILIVALNTLSIASEHHNQ PGTSFGISVLRALRLLRIFKV PGSSFGISVLRALRLLRIFKV PGTSFGISVLRALRLLRIFKI IMSPLGISVFRCVRLLRIFKV AMQPLGISVLRCVRLLRIFKV IMSPLGISVLRCVRLLRIFKI AMTPLGISVLRCIRLLRIFKI FALLGMQLFGGQFNFDEGTPFALLGMQLFGGQFNFQDETPFALLGMQLFGGRFNFNDGTPFSLLGMQLFGGKFNFDETQTK FSLLGMQLFGGKFNFDQTHTK FSLLGMQLFGGKFNFDEMQTR FALLGMQLFGGRYDFEDTEVR ERRRRHRHGAPATYEGDARRE EPARRHRARHKAQPAHEAVEK QDLRRTNSLMVSGLAGGL --------------------------------------------------------------------------------- O00555|CACNA1A_ HOME Q1ADE8|Q1ADE8_VACA P97445|CACNA1A_RATOLÍ P54282|CACNA1A_RATA P27884|CACNA1A_CONILL P91645|CACNA1A_DROME WTVLSLVALNTLCVAIVHYNQ WTVLSLVALNTLCVAIVHYNQ WTVLSLVALNTLCVAIVHYNQ WTVLSLVALNTLWLAIVHYNQ WTVLSLVALNTLCVAIVHYNQ WFVIVLVFLNTVCVAVEHYGQ PGTSFGISVLRALRLLRIFKV PGTSFGISVLRALRLLRIFKV PGTSFGISVLRALRLLRIFKV PGTSFGISVLRALRLLRIFKV PGTSFGISVLRALRLLRIFKV –GGSFGLSVLRALRLLRIFKV FALLGMQLFGGQFNFDEGTPP FALLGMQLFGGQFNFDEGTPP FALLGMQLFGGQFNFDEGTPP FALLGMQLFGGQFNFDEGTPP FALLGMQLFGGQFNFDEGTPP FALLGMQLFGGQFNLPGGTPE ERRRRHRHGAPATYEGDARRE ERRRRHRHGPPPAYDADMRRE ERKRRHRHGPP-------AHD ERKRRHRHGPP-------AHD ERRRRHRHGPPPAYDPDARRD --------------------- Figura 3. Alineament proteic realitzat amb el programa ClustalW (www.ebi.ac.uk/clustalw). Els residus Thr501, Arg583 i Gly638 de la proteïna CACNA1A humana estan conservats en totes les subunitats α1 estudiades (CACNA1B, E, D, F, C i S), però no així l’aminoàcid Pro1011, el més C-terminal dels canvis identificats. Les quatre posicions estan conservades a la proteïna ortòloga de diversos organismes. La posició mutada es destaca en negre i les regions no conservades, en gris. Davant de cada seqüència protèica hi ha el codi SwissProt. HOME: Homo sapiens, VACA: Bos taurus, RATOLÍ: Mus musculus, RATA: Rattus norvegicus, CONILL: Oryctolagus cuniculus, DROME: Drosophila melanogaster. Mutació p.Arg583Gln: És una mutació ja descrita prèviament, situada a l’exó 13 del gen CACNA1A en el pacient 1 (figura 2), que correspon al cas índex (II.3) d’una família amb migranya i atàxia (figura 1). Es va estudiar la presència/absència del canvi identificat a la resta d’individus de la família i es va detectar en tots els individus afectats i portadors de l’al·lel 3 del marcador intragènic D19S1150 i en cap dels individus sans (figura 1). La mutació cosegrega amb tots els fenotips d’atàxia de la família, que inclouen EA2 en els individus més joves - un d’ells és portador de la mutació (III.2) i l’altre no va ser analitzat per falta de consentiment (III.1)-, atàxia i atròfia cerebel·losa, que és present en dos individus portadors de la mutació (I.2 i II.6) i atàxia, atròfia cerebel·losa i MA (individu II.3) o HM (individu II.7). Aquesta mutació provoca el canvi de l’aminoàcid arginina, amb càrrega positiva, per una glutamina, un residu polar no carregat, en el segment S4 del segon domini de la proteïna, S4DII (figura 2), situat en el sensor de voltatge del canal. Aquesta posició està molt conservada tant a nivell interespecífic com intraespecífic 145 RESULTATS Anàlisi mutacional (figura 3). Aquesta és la segona mutació més prevalent identificada fins ara al gen CACNA1A, amb un mínim de 7 casos familiars i un cas esporàdic (Battistini et al., 1999; Ducros et al., 2001; Terwindt et al., 2001; Alonso et al., 2003; Thomsen et al., 2007). 146 CAPÍTOL 3 EPISODIC SPONTANEOUS HYPOTHERMIA WITH HYPERHIDROSIS IN A PATIENT WITH A NOVEL CACNA1A VARIANT: EVIDENCE FOR A NEW MIGRAINE PRECURSOR? E. Cuenca-León, R. Corominas, B. Cormand and A. Macaya ARTICLE 3 EN PREPARACIÓ Capítol 3- Article 3 RESULTATS RESUM Hipotèrmia episòdica espontània amb hiperhidrosi en un pacient amb una nova variant al gen CACNA1A: un nou precursor de migranya? Es va identificar una pacient de 7 mesos d’edat que presentava episodis periòdics d’hipotèrmia amb hiperhidrosi i absència de tremolors. Als sis anys d’edat els episodis d’hipotèrmia persistien i va començar a tenir cefalees recurrents. També es va documentar apnea obstructiva del son. La pacient té història familiar de migranya i epilèpsia. L’anàlisi mutacional del gen CACNA1A va revelar una mutació a l’exó 20. Es tracta d’una transversió de C a G a la posició 3638 del cDNA (c.3638C>G), que dóna com a resultat la substitució d’un residu de prolina per un d’alanina (p.Pro1138Ala) en el bucle intracel·lular situat entre els dominis DII i DIII de la proteïna. Tot i que encara no s’han estudiat les conseqüències funcionals, aquest canvi podria posar de manifest un mecanisme fisiopatològic comú entre la hipotèrmia episòdica espontània amb hiperhidrosi (ESHH) i la migranya. Així, la ESHH podría situar-se com a una nova variant de síndromes periòdiques de la infància (CPS). El defecte en la termoregulació podria ser conseqüència d’una disfunció hipotalàmica, fet que relacionaria la ESHH amb altres cefalees primàries, principalment amb la cefalea acuminada o en clusters. 149 Capítol 3- Article 3 RESULTATS EPISODIC SPONTANEOUS HYPOTHERMIA WITH HYPERHIDROSIS IN A PATIENT WITH A NOVEL CACNA1A VARIANT: EVIDENCE FOR A NEW MIGRAINE PRECURSOR? E. Cuenca-León, R. Corominas, B. Cormand1 and A. Macaya Grup de Recerca Neurologia Infantil i Psiquiatria Genètica, Hospital Universitari Vall d’Hebron, 1Departament de Genètica, Facultat de Biologia, Universitat de Barcelona , CIBER Enfermedades Raras, Instituto de Salud Carlos III, Institut de Biomedicina de la Universitat de Barcelona (IBUB), Barcelona, Spain Correspondence: Alfons Macaya, MD Grup de Recerca Neurologia Infantil i Psiquiatria Genètica Hospital Universitari Vall d’Hebron Pg. Vall d’Hebron 119-129, 08035 Barcelona, Spain Tel. +34 93 4894334 Fax: +34 93 2746837 Email: [email protected] 151 RESULTATS Hipotèrmia: CPS? ABSTRACT A young girl presented at the age of 7 months with periodic episodes of hypothermia with absent shivering and hyperhidrosis. Her family history was notable for the presence of both migraine and partial epilepsy. At age 6 years the hypothermia episodes persisted and she had developed recurrent headaches. Obstructive sleep apnea was documented. A mutation in exon 20 of the CACNA1A gene was detected. A C to G transversion at cDNA nucleotide 3638 resulted in a replacement of a proline for an alanine residue, p.Pro1138Ala, in the intracellular loop between the domains DII and DIII of the protein. The functional consequences of this change are unclear, but it raises the issue of a common pathophysiology of episodic spontaneous hypothermia with hyperhidrosis (ESHH) and migraine. This finding may therefore support the inclusion of ESHH as a new variant of childhood periodic syndrome. Thermoregulation failure might also result from hypothalamic dysfunction; in this respect the condition might also relate to other primary headaches, most notably cluster headache. 152 RESULTATS Capítol 3- Article 3 INTRODUCTION Hypothermia is defined as core body temperature below 35ºC. Nonenvironmental hypothermia occurs infrequently in childhood; some well known acquired causes are brain tumors, sepsis, endocrinologic disturbances and drug intoxications. It has been also described in adults with brain injury (1), subarachnoidal hemorrhage (2), limbic encephalitis (3) or multiple sclerosis (3). Some rare congenital syndromes may present with episodic hypothermia, including agenesis of the corpus callosum (Shapiro syndrome) and semilobar holoprosencephaly (3, 4). The majority of instances of pediatric episodic hypothermia are, however, considered idiopathic and most commonly referred to as episodic spontaneous hypothermia with hyperhidrosis (ESHH). The profuse sweating that characterizes this condition and the typical absence of shivering during the hypothermia, point to a lowered body temperature set point in ESHH. In the aggregate, the diverse causes of episodic hypothermia are thought to result from a disorder of thermoregulation, most likely arising from periodic hypothalamic dysfunction. Episodic brainstem dysregulation, but also of its interconnected hypothalamic areas (4), has been also proposed to play a pivotal role in the generation of the migraine attack, another paroxysmal disorder. The character of the premonitory symptoms of the migraine attack, its circadian rhythmicity and the dependence on hormonal fluctuations, are all clues towards a transient hypothalamic dysfunction in the initiation of migraine (5). Indeed, some clinical observations (6) led to postulate that ESHH may represent a novel variant of childhood periodic syndromes (CPS), the ICHD-IIdefined category encompassing the phenotypes considered as pediatric 153 RESULTATS Hipotèrmia: CPS? precursors of migraine (7). To our knowledge, there have been no studies addressing the molecular basis of ESHH. PATIENTS AND METHODS Patients A 17 month-old girl presented with a clinical history of recurrent episodes of hypothermia (core temperature between 34 and 35ºC) pallor and profuse diaphoresis. The first episode occurred at the age of seven months. According to her parents, during the episode the patient was unable to remain seated and appeared much less active. In subsequent episodes, once the patient attained independent walking, some degree of instability became evident. While the patient was hypothermic, there was a conspicuous absence of shivering. Episodes lasted typically from a few minutes to 1 hour, after which mild somnolence was sometimes noted, and their frequency was between one and four per month during the first four years of life. They were more common at night, during sleep, and were rarely recorded during daytime. The family history was notable for a nine year-old brother had been diagnosed with focal idiopathic epilepsy at age 5. He received carbamazepine for three years and remained seizure-free after discontinuation of the drug. Both of the patient parents had a history of recurrent headaches. The patient’s father had headaches fulfilling the criteria for migraine without aura, while the mother had a relatively recent onset of tension-type headaches. However, telephone interviews revealed that the maternal great-grandmother, the grandmother, her sister and a daughter of the latter (Figure 1), all complained of migraine without 154 Capítol 3- Article 3 RESULTATS aura and occasional bouts of vertigo. No other relative had other paroxysmal neurological events, including epilepsy or episodic ataxia. Interictally, the patient’s physical examination was unremarkable. Mental status, cranial nerve function, muscle strength, sensory examination, gait and coordination were normal. There were brisk tendon reflexes and flexor plantar responses bilaterally. Two hypochromic maculae were noted over the abdomen and left lower limb. Her psychomotor development was judged adequate overtime. Laboratory exams included blood sugar at time of hypothermia episodes and serum lactate, ammonia and amino acids, urine organic acids and EEG soon after the episodes. A polysomnogram at age five years showed an ApneaHypopnea index of 16.1, consistent with sleep apnea syndrome. The concurrent EEG recording showed physiological theta hypnagogic arousals but no epileptiform discharges or asymmetries. A brain MRI at the age of 23 months revealed some periventricular white matter hypomyelination (terminal myelination) but was otherwise normal. By age six, the patient continues to show a normal exam and is attending normal school. The frequency of the episodes of hypothermia has diminished to less than one per month. Since age five, the patient complains, as a separate type of paroxysms, from headache attacks. The headache, lasting about 2 hours, is of moderate-severe intensity and predominates over the occipital region, although the age of the patient hampers the formal assessment of the IHS criteria. 155 RESULTATS Hipotèrmia: CPS? Samples Peripheral blood venous samples were obtained from the proband and five family members, as well as from 100 healthy Spanish individuals, in whom paroxysmal neurological diseases were specifically ruled out, that were used as control population. Genomic DNA was isolated from leucocytes using a standard salting-out procedure (8). The study was approved by the local IRB and each subject gave informed consent for DNA analysis. DNA and Mutation analysis The CACNA1A gene was screened for mutations since the proband phenotype, an unusual episodic brain disorder, and the family history of paroxysmal neurological signs, including migraine, raised the suspicion of a neuronal channelopathy. Exons of the CACNA1A gene (NM_023035.1) and exon/intron junctions including splice sites and branch points, were amplified from the index proband in a total of 42 independent PCR products. Primers were designed using the Primer3 software (frodo.wi.mit.edu/cgi-bin/primer3/primer3_www.cgi) (9). The general PCR procedure was: 100ng of genomic DNA, 0.2mM dNTPs, 5pmol of each primer, 0.75U AmpliTaq Gold polymerase (Applied Biosystems), 1XGold buffer with 2mM MgCl2 in a final volume of 50µl. The mixes were subjected to 10 min at 94ºC, 35 cycles of 1 min at 94ºC, 1 min at 53 to 62ºC (depending on the specific PCR fragment) and 1 min at 72ºC, and a final extension step of 10 min at 72ºC. Exons 19, 20, 36, 38, 41 and 44 were supplemented with 5% DMSO and exons 1, 13+14, 45+46 and 47 needed a different PCR procedure. Primer sequences and specific PCR conditions are available from the authors upon request. 156 Capítol 3- Article 3 RESULTATS The PCR products were column-purified using the GFX PCR DNA and Gel Band purification Kit (Amersham Pharmacia Biotech, Wien, Austria), sequenced from the reverse PCR primer using the BigDye Terminator Cycle Sequencing Kit v3.1 (Applied Biosystems Foster City, CA), purified with Sephadex G-50 (Amershan Biosciences Freiburg, Germany) using MultiScreen Plates (Millipore, Billerica, MA) and run in an ABI PRISM 3700 DNA analyzer (Applied Biosystems, Foster City, CA). Sequence chromatograms were inspected manually and analysed with the SeqMan v3.6 software (DNASTAR Inc). When a change was observed, a comparison with the reference sequence available at UCSC Human Genome Browser (genome.ucsc.edu) was carried out and the complementary strand from a new PCR product was sequenced for confirmation. Digestion of the exon 20 PCR product with the FauI restriction enzyme was performed as an additional detection method to confirm the identified mutation (WT: 661bp, mutant allele: 431+230bp). The enzymatic digestion was performed according to the manufacturer’s recommendations, and the resulting products were separated by electrophoresis on a 1.5% agarose gel and stained with ethidium bromide. A group of 100 healthy unrelated Spanish individuals was screened for the presence of the mutation identified in the index proband by FauI restriction of the exon 20 PCR product. The mutation identified in the CACNA1A gene was numbered using the reference sequence NM_023035.1, with nucleotide 283 of that sequence, the A of the ATG initiation codon, corresponding to +1, following the Human Genome Variation Society (HGVS) recommendations. 157 RESULTATS Hipotèrmia: CPS? RESULTS A new mutation was identified in the proband after extensive sequencing of the CACNA1A gene (Figure 2). The index patient displays a novel variant in exon 20, consisting in a C to G transversion at cDNA nucleotide 3638 of the reference sequence NM_023035.1 (c.3638C>G). The change results in a replacement of a proline for an alanine residue, p.Pro1138Ala, in the intracellular loop between the domains DII and DIII of the CACNA1A protein. The presence of the change was confirmed by restriction analysis in the patient and in two relatives: the mother and the maternal grandmother (Figure 2). The mutation was not present in 200 chromosomes from unrelated healthy individuals. DISCUSSION We reported a new case of infantile ESHH where a potentially disease-causing mutation was found in the CACNA1A gene. The etiology of ESHH is unknown. This rare condition has been speculatively ascribed to defective thermoregulation arising from hypothalamic dysfunction. Various observations of secondary episodic hypothermia, often associated with acquired diencephalic lesions or congenital anomalies of corpus callosum, thalamus or hypothalamus may lend support to this hypothesis, which also claims that in ESHH a lowered body temperature set point would produce the body to sweat profusely, in an attempt to maintain the temperature low (10). The hypothalamus is believed to play an important role in primary headaches and other episodic brain disorders such as narcolepsy; it is activated during the initiation of the migraine attack (5) and several lines of evidence suggest a 158 Capítol 3- Article 3 RESULTATS pivotal role of hypothalamus in cluster headache pathophysiology (11). It is thus conceivable that episodic disordered thermoregulation might constitute a migraine equivalent or be in some way related to the primary headaches arising in the hypothalamic region. Some evidences seem to support the contention that ESHH is a migraine variant, akin to other CPS. Four unrelated cases of ESHH had concurrent manifestations of either migraine or CPS (cyclical vomiting) and family history of migraine in three of them (6). Also the 5 year-old girl reported by Greenberg and Rittichier (12) had a family history of migraine in her father and panic attacks in several other relatives. Some of the clinical symptoms accompanying hypothermia both in our patient and in those from previous reports (6), such as droopiness or somnolence, are reminiscent of those featured in CPS. Our patient has also developed recurrent headaches at preschool age. Conversely, ESHH has also been proposed to represent a form of diencephalic epilepsy (10). This would not thwart the notion of CACNA1A mutation pathogenicity, since several generalized epilepsy phenotypes have been linked to this gene (13, 14). An alternative view would be that ESHH represents an early form of cluster headache (CH) a severe form of primary headache which characteristically does not present in childhood. Both entities have nocturnal presentation and have been related to hypothalamic dysfunction. Polysomnograms have been repeatedly obtained in CH and it is of note that obstructive sleep apnea has been found in over 80% of patients (15). Our patient, who also had predominantly nocturnal episodes, had significant obstructive sleep apnea. If ESHH is indeed a CPS, this is only the third reported patient with a migraine precursor exhibiting an apparently causative mutation in a migraine-related 159 RESULTATS Hipotèrmia: CPS? gene. Giffin et al. (16) reported a case of benign paroxysmal torticollis that, although not subjected to genetic analysis, belonged into a FHM pedigree carrying a missense mutation in the CACNA1A gene. We have recently reported a mutation in a young infant presenting with BPTI, which later evolved into BPV and then to migraine (17). Regarding our molecular findings, the mechanism through which a mutation in a calcium channel subunit should produce episodic hypothermia is far from obvious. Interestingly, the hypothalamus is densely populated with neurons expressing the Cav2.1 channel (www.genecards.org). Although CACNA1A mutations are common in FHM (18) (17), none has been found in the single series of patients with cluster headache which was subjected to mutational screen (19). The missense mutation p.Pro1138Ala is expected to produce a more benign phenotype, such as ESHH, through a gain of function, as it happens with most FHM analyzed mutations, rather than a severe phenotype, as is the case of some EA2 with cerebellar progressive ataxia resulting from CACNA1A null alleles (20). Although the present results do not substantiate the pathogenicity of the described change, some clues may suggest a causal relationship between the mutation and the phenotype of the index patient: First, the mutant alanine substitutes a proline, present in the normal protein, that is structurally disruptive. Second, the change is located in the intracellular linker between domains DII and DIII of the protein, close to the SNARE protein binding site. The SNARE proteins mediate neurotransmitter vesicles fusion at the presynaptic membrane, so abnormal interaction with the channel could 160 Capítol 3- Article 3 RESULTATS compromise neurotransmitter exocytosis (21). Third, the mutation is highly conserved in evolution at interspecific level (mouse –Mus musculus-, rat -Rattus norvegicus-, cattle -Bos taurus- and rabbit -Oryctolagus cuniculus- α1A subunits). The position, is conserved in CACNA1B and not in CACNA1E, but does not exist in the other paralogous human proteins, thus precluding further comparisons (Figure 3). And fourth, the mutation was not detected in a screening of 200 control chromosomes from non-migraneurs. Finally, only in vitro functional studies showing altered electrophysiological properties of the p.Pro1138Ala mutated channel will eventually allow confirmation of causality of the described phenotype. Follow-up data on the ESHH patients reported thus far is clearly warranted. Whether this intriguing condition is an early form of migraine, of another primary headache, such as CH, another channelopathy as epilepsy, or even a channelopathy on its own right, remains to be elucidated. REFERENCES 1. De Tanti A, Gasperini G, Rossini M. Paroxysmal episodic hypothalamic instability with hypothermia after traumatic brain injury. Brain Inj 2005;19(14):1277-1283. 2. Tuettenberg J, Woitzik J, Siegel L, Thome C. Episodic hypothermia and hyperhidrosis after subarachnoid hemorrhage. Case illustration. J Neurosurg 2003;99(3):610. 3. Fukushima K, Yasaki M, Kaneko K, Fushimi T, Yamamoto K, Hashimoto T, et al. Nonparaneoplastic, nonherpetic limbic encephalitis with severe episodic hypothermia: a case report. Eur Neurol 2005;54(3):170-174. 161 RESULTATS Hipotèrmia: CPS? 4. McPherson M, Jokl DH, Almeda EE, Jr. Bilateral persistent fetal vasculature associated with holoprosencephaly. J Pediatr Ophthalmol Strabismus 2004;41(4):236-237. 5. Overeem S, van Vliet JA, Lammers GJ, Zitman FG, Swaab DF, Ferrari MD. The hypothalamus in episodic brain disorders. Lancet Neurol 2002;1(7):437-444. 6. Ruiz C, Gener B, Garaizar C, Prats JM. Episodic spontaneous hypothermia: a periodic childhood syndrome. Pediatr Neurol 2003;28(4):304-306. 7. The International Classification of Headache Disorders: 2nd edition. Cephalalgia 2004;24 Suppl 1:9-160. 8. Miller SA, Dykes DD, Polesky HF. A simple salting out procedure for extracting DNA from human nucleated cells. Nucleic Acids Res 1988;16(3):1215. 9. Rozen S, Skaletsky H. Primer3 on the WWW for general users and for biologist programmers. Methods Mol Biol 2000;132:365-386. 10. Kloos RT. Spontaneous periodic hypothermia. Medicine (Baltimore) 1995;74(5):268-280. 11. Holland P, Goadsby PJ. The hypothalamic orexinergic system: pain and primary headaches. Headache 2007;47(6):951-962. 12. Greenberg RA, Rittichier KK. Pediatric nonenvironmental hypothermia presenting to the emergency department: Episodic spontaneous hypothermia with hyperhidrosis. Pediatr Emerg Care 2003;19(1):32-34. 162 RESULTATS Capítol 3- Article 3 13. Kors EE, Melberg A, Vanmolkot KR, Kumlien E, Haan J, Raininko R, et al. Childhood epilepsy, familial hemiplegic migraine, cerebellar ataxia, and a new CACNA1A mutation. Neurology 2004;63(6):1136-1137. 14. Jouvenceau A, Eunson LH, Spauschus A, Ramesh V, Zuberi SM, Kullmann DM, et al. Human epilepsy associated with dysfunction of the brain P/Q-type calcium channel. Lancet 2001;358(9284):801-807. 15. Deprez L, Peeters K, Van Paesschen W, Claeys KG, Claes LR, Suls A, et al. Familial occipitotemporal lobe epilepsy and migraine with visual aura: linkage to chromosome 9q. Neurology 2007;68(23):1995-2002. 16. Giffin NJ, Benton S, Goadsby PJ. Benign paroxysmal torticollis of infancy: four new cases and linkage to CACNA1A mutation. Dev Med Child Neurol 2002;44(7):490-493. 17. Cuenca-León E, Corominas R, Fernández-Castillo N, Volpini V, del Toro M, Roig M, Macaya A, Cormand B. Genetic analysis of 27 Spanish patients with hemiplegic migraine, basilar-type migraine and childhood periodic syndromes. Cephalalgia 2008;(in press). 18. Pietrobon D. Familial hemiplegic migraine. Neurotherapeutics 2007;4(2):274-284. 19. Pinessi L, Rainero I, Rivoiro C, Rubino E, Gallone S. Genetics of cluster headache: an update. J Headache Pain 2005;6(4):234-236. 19. Strupp M, Zwergal A, Brandt T. Episodic ataxia type 2. Neurotherapeutics 2007;4(2):267-273. 21. Mochida S, Sheng ZH, Baker C, Kobayashi H, Catterall WA. Inhibition of neurotransmission by peptides containing the synaptic protein interaction site of N-type Ca2+ channels. Neuron 1996;17(4):781-788. 163 RESULTATS Hipotèrmia: CPS? ACKNOWLEDGEMENTS The authors wish to thank all the patients and family members for their cooperation This study was supported by the Spanish Ministry of Education and Science (SAF2000/197 and SAF-2003/04704), Red Española de Ataxias, Fondo de Investigación Sanitaria, Spain (G03/056 and PI052129), Instituto de Salud Carlos III, Spain (PI061073, PI050996) and AGAUR (2005SGR00848). E.C-L. was a recipient of a FPI scholarship of the Ministerio de Ciencia y Tecnología, Spain. R.C. was funded by the Institut de Recerca Vall d’Hebron. 164 Capítol 3- Article 3 RESULTATS FIGURE LEGENDS Figure 1. A three generation Spanish pedigree with episodic spontaneous hypothermia (arrow, index case), migraine and vertigo attacks. Figure 2. The index patient displays a novel variant in exon 2, consisting in a C to G transversion at nucleotide 3638 of the reference cDNA sequence NM_023035.1 with nucleotide A of the ATG initiation codon (nucleotide 283) corresponding to +1. The change results in a replacement of a proline for an alanine residue, p.Pro1138Ala. The presence of the change was confirmed by restriction analysis of the PCR product of exon 20 in the patient and two relatives. The FauI restriction enzyme generated band patterns of 661bp in the WT allele and 431+230bp in the mutant allele. ND= non digested. Figure 3. Protein alignment performed with clustalW (www.ebi.ac.uk/clustalw). The human CACNA1A Pro1138 residue is conserved in the orthologous CACNA1A proteins of several organisms, whereas it is conserved only in the human calcium channel subunit CACNA1B, since the position is not present in the other shorter CACNA1 human proteins. Non-conserved amino acids are marked in grey. The RefSeq code of each protein is indicated. HUMAN: Homo sapiens, CATTLE: Bos taurus, MOUSE: Mus musculus, RAT: Rattus norvegicus, RABBIT: Oryctolagus cuniculus. 165 RESULTATS Hipotèrmia: CPS? I.1 I.2 II.1 II.2 II.3 III.1 II.4 III.2 II.5 III.3 III.4 Headache IV.1 Migraine with aura IV.2 Vertigo Hypothermia Migraine without aura Figure 1 19p13.13 CACNA1A c.3638C>G (p.Pro1138Ala) - 650bp 500bp 400bp 300bp 200bp ND II.2 II.3 p.Pro1138Ala/+ III.2 III.1 +/+ p.Pro1138Ala/+ IV.1 +/+ Figure 2 166 IV.2 p.Pro1138Ala/+ 1 Kb RESULTATS Capítol 3- Article 3 p.Pro1138Ala O00555|CACNA1A_HUMAN Q00975|CACNA1B_HUMAN Q15878|CACNA1E_HUMAN Q01668|CACNA1D_HUMAN O60840|CACNA1F_HUMAN Q13936|CACNA1C_HUMAN Q13698|CACNA1S_HUMAN NPGNPSNPGPPKTPENSLIVT ----------PEDADNQRNVT --------TDKATTESTSVTV --------------------------------------------------------------------------------- O00555|CACNA1A_HUMAN P97445|CACNA1A_MOUSE P54282|CACNA1A_RAT Q1ADE8|CACNA1A_CATTLE P27884|CACNA1A_RABBIT NPGNPSNPGPPKTPENSLIVT NPGNPSNPGPPKTPENSLIVT NPGNPSNPGPPKTPENSLIVT NPGNPSNPGPPKTPENSLIVT NPGNPSNPGPPKTPENSLIVT Figure 3 167 CAPÍTOL 4 A MUTATION IN THE FIRST INTRACELLULAR LINKER OF CACNA1A MODIFIES P/Q CHANNEL REGULATION BY CAVβ SUBUNITS, G PROTEINS AND SYNTAXIN-1A UNDER CONDITIONS OF HIGH ELECTRICAL ACTIVITY. Selma A. Serra, Ester Cuenca-León, Artur Llobet, Noelia Fernández-Castillo, Roser Corominas, Jacqueline Fernandes, Miguel A. Valverde, Alfons Macaya, Bru Cormand and José M. Fernández-Fernández. ARTICLE 4 NATURE NEUROSCIENCE - EN 2A REVISIÓ Capítol 4 – Article 4 RESULTATS RESUM Una mutació en el primer llaç intracel·lular de la proteïna CACNA1A modifica la regulació del canal de tipus P/Q, la unió a sintaxina 1A i baixa l’eficiència de secreció: rellevància pel fenotip clínic de la migranya. Les mutacions responsables de migranya hemiplègica familiar (FHM) en el gen que codifica la subunitat α1A del canal de Ca2+ de tipus P/Q (CACNA1A) estan situades a les regions del porus o del sensor de voltatge i impliquen en general un guany de funció del canal. En aquest treball es descriu una mutació situada al primer llaç intracel·lular (ILI-II) del canal CACNA1A (α1A(A454T)) associada a la manca de símptomes sensitivo-motors en una família amb migranya amb aura. El canal α1A(A454T) presenta alteracions en la regulació de la inactivació de l’estat de repòs dependent de voltatge per part de les subunitats CaVβ. El canal α1A(A454T) també mostra una inactivació accelerada després d’una despolarització facilitadora, mediada pels dímers βγ de la proteïna G. A més, la mutació A454T impedeix la interacció de la sintaxina 1A amb el canal P/Q i per tant, aboleix la modulació del canal a través de la sintaxina 1A i, conseqüentment, redueix l’eficàcia de secreció. Els nostres resultats suggereixen un nou paper de l’ILI-II en la interacció entre el canal de tipus P/Q i la sintaxina 1A i indiquen que variants en el gen CACNA1A poden, a vegades, no ser les responsables del fenotip sinó participar com a modificadors d’aquest. 171 Capítol 4- Article 4 RESULTATS 173 RESULTATS 174 p.Ala454Tyr: estudis funcionals Capítol 4- Article 4 RESULTATS 175 RESULTATS 176 p.Ala454Tyr: estudis funcionals Capítol 4- Article 4 RESULTATS 177 RESULTATS 178 p.Ala454Tyr: estudis funcionals Capítol 4- Article 4 RESULTATS 179 RESULTATS 180 p.Ala454Tyr: estudis funcionals Capítol 4- Article 4 RESULTATS 181 RESULTATS 182 p.Ala454Tyr: estudis funcionals Capítol 4- Article 4 RESULTATS 183 RESULTATS 184 p.Ala454Tyr: estudis funcionals Capítol 4- Article 4 RESULTATS 185 RESULTATS 186 p.Ala454Tyr: estudis funcionals Capítol 4- Article 4 RESULTATS 187 RESULTATS 188 p.Ala454Tyr: estudis funcionals Capítol 4- Article 4 RESULTATS 189 RESULTATS 190 p.Ala454Tyr: estudis funcionals Capítol 4- Article 4 RESULTATS 191 RESULTATS 192 p.Ala454Tyr: estudis funcionals Capítol 4- Article 4 RESULTATS 193 RESULTATS 194 p.Ala454Tyr: estudis funcionals Capítol 4- Article 4 RESULTATS 195 RESULTATS 196 p.Ala454Tyr: estudis funcionals Capítol 4- Article 4 RESULTATS 197 RESULTATS 198 p.Ala454Tyr: estudis funcionals Capítol 4- Article 4 RESULTATS 199 RESULTATS 200 p.Ala454Tyr: estudis funcionals Capítol 4- Article 4 RESULTATS 201 RESULTATS 202 p.Ala454Tyr: estudis funcionals Capítol 4- Article 4 RESULTATS 203 RESULTATS 204 p.Ala454Tyr: estudis funcionals Capítol 4- Article 4 RESULTATS 205 RESULTATS 206 p.Ala454Tyr: estudis funcionals Capítol 4- Article 4 RESULTATS 207 RESULTATS 208 p.Ala454Tyr: estudis funcionals Capítol 4- Article 4 RESULTATS 209 RESULTATS 210 p.Ala454Tyr: estudis funcionals Capítol 4- Article 4 RESULTATS 211 RESULTATS 212 p.Ala454Tyr: estudis funcionals Capítol 4- Article 4 RESULTATS 213 RESULTATS 214 p.Ala454Tyr: estudis funcionals Capítol 4- Article 4 RESULTATS 215 RESULTATS 216 p.Ala454Tyr: estudis funcionals Capítol 4- Article 4 RESULTATS 217 RESULTATS 218 p.Ala454Tyr: estudis funcionals