Survey
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
APECED: monogenic autoimmune disease Pärt Peterson University of Tampere, Finland University of Tartu, Estonia APS1 or APECED • APS1 (autoimmune polyendocrine syndrome type 1) or APECED (autoimmune polyendocrinopathy candidiasis ectodermal dystrophy) • Autosomal recessive inheritance • More prevalent in some populations such as Finns (1:25000), Iranian Jews (1:9000) and Sardinians (1:14400). Very high incidence (1/4400) reported in a small town Bassa del Grappa, in Northern Italy • No HLA association Autoimmune regulator (AIRE) is a gene mutated in APECED Clinical Features • Endocrinopathies • Chronic mucocutaneous candidiasis – Hypoparathyreoidism • Ectodermal dystrophies – Addison’s disease – dental enamel – Gonadal dysfunction – nails – Type 1 diabetes mellitus – alopecia – Autoimmune thyroiditis – vitiligo – Autoimmune gastritis • Autoimmune hepatitis • Keratopathy Candida infection and vitiligo of APS1 patient From Prof. Olle Kämpe, Uppsala University APS1/APECED and APS2 are two different syndromes Disease components APS1 APS2 Addison’s disease 60-100 70-100 Hypoparathyroidism 77-100 absent Chronic candidiasis 73-100 absent Ectodermal dysplasia 10-77 absent Autoimmune thyroid disease 8-18 69-83 Type 1 diabetes 4-23 28-52 Hypogonadism 31-60 9 Alopecia 27-72 2-5 Vitiligo 4-26 4-11 Keratopathy 12-35 absent Autoimmune hepatitis 10-19 4 Pernicious anemia 12-15 2-25 6 11 Chronic gastritis Autoantigens in Addison’s disease • Steroid 17a-hydroxylase, P450c17 • Steroid 21-hydroxylase, P450c21 • Side-chain cleavage enzyme, P450scc Thomas Addison All three P450 enzymes are active in steroidogenesis in adrenal cortex. P450c21 is expressed only in adrenal cortex, P450c17 and P450scc are also expressed in gonads Krohn et al. Lancet 339: 770, 1992 Uibo et al. JCEM 78: 323, 1994 APS1/APECED autoantigens Autoantigen Prevalence % Steroid 21 hydroxylase (P450c21) 66 Side-chain cleavage enzyme (P450scc) 52 Steroid 17 alpha hydroxylase (P450c17) 44 Aromatic L-amino acid decarboxylase (AADC) 51 Glutamic acid decarboxylase (GAD65) 37 Histidine decarboxylase (HDC) 37 Cysteine sulfinic acid decarboxylase (CSAD) 3.6 Tryptophan hydroxylase (TPH) 45 Tyrosine hydroxylase (TH) 44 Thyroglobulin (TG) 36 Thyroid peroxidase (TPO) 36 Transcription factor SOX10 22 Cytochrome P4501A2 (P4501A2) 8 Tyrosine phosphatase-like protein IA-2 (IA-2) 7 AIRE protein •N-terminal HSR domain: homodimerisation •SAND domain: putative DNA binding •PHD finger: transcriptional regulation •Proline rich region •LXXLL motif: binding to nuclear receptors Nagamine et al. Nat Genetics 17: 393, 1997 The Finnish-German Consortium. Nat Genetics 17: 399, 1997 Similarity to Nuclear Proteins Mi-2: helicase, involved in chromatin remodelling, autoantigen in dermatomyositis TIF1: transcriptional coactivator Sp100: interferon responsive, transcription activator, autoantigen in PBC, lymphoid restricted Sp140: homologous protein to Sp100, autoantigen in PBC Expression in the Thymus •The major AIRE expressing tissue is the thymus •Lower levels of expression are seen in the fetal liver, spleen and lymph nodes •In the thymus, AIRE is seen in a distinct subset of cells in situ hybridisation Anti-AIRE ab Heino et al. BBRC 257: 821, 1999 Subcellular localization Aire localizes to nuclear dots in thymus medulla and in transfected Cos cells Human and Mouse AIRE proteins are 77% identical 545 516 520 475 430 434 340 350 299 280 189 100 63 67 7 11 aa AIRE L HSR/ASS L NLS SAND PHD PRR L (23.5%) PHD L 552 520 524 475 430 434 342 352 301 279 188 99 64 68 8 12 aa Aire L HSR/ASS L NLS SAND PHD PRR (16%) L PHD L mouse : MAGGDGMLRRLLRLHRTEIAVAIDSAFPLLHALADHDVVPEDKFQETLRLKEKEGCPQAFHALLSWLLTRDSGAILDFWRILFKDYNLERYSRLHSILDGFPKDVDLNQSR : 111 human : MA-TDAALRRLLRLHRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLHLKEKEGCPQAFHALLSWLLTQDSTAILDFWRVLFKDYNLERYGRLQPILDSFPKDVDLSQPR : 110 ASS L L mouse : KGRKPLAGPKAAVLPPRPPTKRKALEEPRATPPATLASKSVSSPGSHLKTKPPKKPDGNLESQHLPLGNGIQTMAASVQRAVTVASGDVPGTRGAVEGILIQQVFESGRSK : 222 human : KGRKPPAVPKALVPPPRLPTKRKASEEARAAAPAALTPRGTASPGSQLKAKPPKKPESSAEQQRLPLGNGIQTMSASVQRAVAMSSGDVPGARGAVEGILIQQVFESGGSK : 221 NLS mouse : KCIQVGGEFYTPNKFEDPSGNLKNKARSGSSLKPVVRAKGAQVTIPGRDEQKVGQQCGVPPLPSLPSEPQVNQKNEDECAVCHDGGELICCDGCPRAFHLACLSPPLQEIP : 333 human : KCIQVGGEFYTPSKFED-SGSGKNKARSSSGPKPLVRAKGAQGAAPGGGEARLGQQGSVPAPLALPSDPQLHQKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIP : 331 SAND PHD mouse : SGLWRCSCCLQGRVQQNLSQPEVSRPPELPAETPILVGLRSASEKTRGPSRELKASSDAAVTYVNLLAPHPAAPL--LEPSALCPLLSAGNEGRPGPAPSARCSVCGDGTE : 442 human : SGTWRCSSCLQATVQEVQPRAEEPRPQEPPVETPLPPGLRSAGEEVRGPPGEPLAGMDTTLVYKHLPAPPSAAPLPGLDSSALHPLLCVGPEGQQNLAPGARCGVCGDGTD : 442 L mouse : VLRCAHCAAAFHWRCHFPTAAARPGTNLRCKSCSADSTPTPGTPGEAVPTSGPRPAPGLAKVGDDSASHDPVLHRDDLESLLNEHSFDGILQWAIQSMSRPLAETPPFSS : 552 human : VLRCTHCAAAFHWRCHFPAGTSRPGTGLRCRSCSGDVTPAP-VEGVLAPSP-ARLAPGPAK--DDTASHEPALHRDDLESLLSEHTFDGILQWAIQSMARPAA---PFPS : 545 PHD L Mittaz et al. BBRC, 255: 483, 1999 Aire co-localizes with epithelial cell markers in thymus medulla MTS5 MTS10 Spl macroph. Thymocytes Spl CD4-8+DC Spl CD4-8-DC Spl CD4+8-DC Thy CD8lo/-DC Thy CD8+ DC AIRE is expressed in Dendritic cells Aire b-actin AIRE mRNA is upregulated in vitro stimulated human DCs Several subclasses of mouse dendritic cells express Aire Cortex Thymocyte differentiation Double negative CD4- CD8No T-cell receptor Medulla Double positive CD4+ CD8+ T-cell receptor Single positive CD4+ CD8or CD4- CD8+ T-cell receptor Thymocytes are selected differentially according to their reactivity TCR reactive to non-self antigens Cells survive and when meeting pathogen will proliferate T-cell precursor TCR reactive to self antigens Cell death Autoimmune diseases and autoantigens Addison’s disease Autoimmune gastritis Pernicious anemia Hashimoto thyroiditis Graves disease Myasthenia gravis Type 1 diabetes Vitiligo Rheumatoid arthritis Multiple sclerosis steroid P450 cytochromes H+/K+ ATPase intrinsic factor thyroid peroxidase, thyroglobulin thyroid receptor Acetylcholine receptor insulin, GAD65 tyrosinase, MART type 2 collagen myelin basic protein Ectopic (promiscuous) expression of self antigens in thymus Many tissue specific autoantigens are expressed in thymus. During negative selection, Tcells to these antigens are deleted. If antigen is not expressed in thymus or is expressed in a different way, this may cause autoimmunity From Gotter et al. 2004 Diverse genes expressed in thymic epithelial cells Tissues specific antigens (pancreas, stomach, brain, eye, liver, muscle, kidney specific genes) Expression of genes expressed during fetal stages, pregnancyassociated genes Expression of male specific genes in females and vice versa Expression of cancer specific antigens Conserved in mice and humans Estimation of 3000 genes (5-10% of known genes) in addition to basal expression of thymic epithelial cells AIRE (autoimmune regulator) gene is central in expressing tissue specific antigens Aire deficient mice have autoantibodies and lymphocytic infiltration in multiple tissues Anderson et al. Science, 2002 Microarray analysis of gene expression in wild-type and Aire deficient mouse The expression of tissue specific genes is lower or non-existing in Aire deficient mouse Anderson et al. Science, 2002 The PHD zinc fingers form the activation domain of AIRE HSR NLS SAND PHD PRR PHD AIRE Interacts with CBP •AIRE binds CBP at its CH1 and CH3 domains by far western and yeast two-hybrid assays •CH1 also binds STAT2 and HIF-1a; CH3 binds E1A and TFIIB CBP: cAMP response element binding (CREB) protein binding protein CBP is implicated in various transcriptional responses regulating growth, differentiation or apoptosis Belongs to the class of transcription co-activators possessing histone acetyltransferase activity (HAT) and thus have the potential to regulate the chromatin structure From Hottiger and Nabel, 2000 CBP/p300 interacts with many transcription activators and coactivators AIRE Colocalises with CBP AIRE CBP merge 3D picture of AIRE dots Nuclear Bodies • Most prominent nuclear bodies are promyelocytic leukemia (PML) nuclear body or POD (PML oncogenic domain) • Approximately 0.3 to 1 micrometers in diameter • Other proteins in nuclear dots are involved in transcription or suspected in chromatin binding (Sp100, CBP, BLM, p53) • Function unknown, activation or degradation site? • Some of the proteins like CBP move in and out. AIRE Function AIRE induces the expression of autoantigens that lead to the elimination of the autoreactive T cells Thymus T cell autoreactive to APECED autoantigen AIRE Thymic epithelial cell expressing autoantigens Loss of Function When AIRE is defective, autoreactive T cells escape selection, and autoimmunity develops Thymus T cell autoreactive to APECED autoantigen No AIRE Thymic epithelial cell expressing autoantigens University of Tampere Jukka Pitkänen Camelia Magureanu Ulla Aapola Niko Sillanpää Astrid Murumägi Maarit Heino Pärt Peterson Kai Krohn WEHI, Melbourne Hamish Scott Li Wu University of Tokushima Mitsuru Matsumoto Keio University, Tokyo Jun Kudoh Nobuyoshi Shimizu University of Würzburg Philipp Ströbel Alex Marx University of Geneva Laureane Mittaz Stylianos Antonarakis University of Birmingham Graham Anderson Eric Jenkinson University of Tartu Ana Rebane Vivian Kont Kaidi Möll Tõnis Org Ingrid Liiv Eneli Õis Annika Reimets Rainis Venta Mario Saare