Survey
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
Biased Antibody Repertoires: From Concept to Implementation Juan C. Almagro, Ph.D Department of Biological Sciences Florida International University Miami, Florida May - July 2005 4. Design and Validation of Topography-Biased Antibody Libraries year 2000 1998 1996 1994 1992 1990 0 1988 1999 1997 1995 1993 1991 1989 1987 1985 1983 1981 1979 1977 1975 1973 1971 1969 1967 0 100 1986 5000 releases per year 200 1984 10000 1982 15000 cumulative 300 1980 Sequences per year 400 1978 Cumulative 20000 1976 Number of structures 25000 1965 Number of sequences Statement of the problem year However, we cannot predict the specificity of a given antibody sequence or structure. Hence, Our understanding of the evolution of the antibody repertoire is limited and antibodies cannot be designed de novo. 4. Design and Validation of Topography-Biased Antibody Libraries Canonical structures (Chothia and Lesk, J. Mol. Biol. 196: 901, ‘87) Taken from Andreas Plückthun’s home page, with permission Type 3 L1 Type 1 Predicting the Specificity of Antibody Sequences Based on the Structure of the Antigen-Binding Site ~ 4,000 antibody sequences Complete sequences VL:VH dimmers Canonical structure in L1, L2, L3, H1 and H2 381 VL:VH sequences Canonical structure classes in the known sequences L1: 5 Expected L2: 1 x L3: 5 x H1: 3 25 H2: 4 x 12 = 300 25 10 20 15 Canonical Structure Classes 10 make ~ 90% of the sample 5 others 1-2-3-1-1 1-1-2-1-1 1-1-4-1-1 1-4-4-1-1 1-4-3-1-1 1-2-1-1-1 1-3-2-1-1 1-3-4-1-1 to the structural diversity 1-2-4-1-1 0 Only L1 and H2 contribute 1-2-2-1-1 Found Vargas-Madrazo et al., J. Mol. Biol. 254: 497, ‘95 Canonical structure classes classified in gross specificities Canonical Structure class H1-H2-L1-L2-L3 Frequency Surface Antigen (22) Polysaccharide (17) Nucleic acid (42) Peptide (19) (%) Protein (169) Hapten (112) 1-1-2-1-1 3.2 56 d 0 0 25 0 19 1-1-4-1-1 3.7 10 0 33 13 0 44 1-2-1-1-1 7.1 5 5 80 5 0 4 1-2-2-1-1 24.5 16 44 0 18 0 23 1-2-3-1-1 2.9 57 43 0 0 0 0 1-2-4-1-1 14.2 11 4 5 24 52 4 1-3-2-1-1 7.9 15 26 0 31 20 8 1-3-4-1-1 10 43 0 14 11 25 6 1-4-3-1-1 6.8 11 0 0 0 0 89 1-4-4-1-1 6.6 4 0 0 41 0 55 others 13.1 26 17 17 6 21 13 Antigen size Vargas-Madrazo et al., J. Mol. Biol. 254: 497, ‘95 Topography-specificity relationship Anti-protein Anti-peptide Anti-hapten Model to correlate loop lengths (in particular L1 and H2) with the specificity Predicting the Specificity of Antibody Sequences Based on the Structure of the Antigen-Binding Site ~ 300 structures 59 unique antibody structures 19 anti-protein 18 anti-peptide 22 anti-hapten Determine residues in contact Residues in contact with proteins, peptides and haptens 1.0 SDR usage Protein Some positions in the antigen-binding site interact with the antigen very often (> 70% of the antibodies). Peptide Hapten 0.5 Others do so with a frequency between 30% and 70%. 0.0 L1 L2 L3 A third group interacts with the antigen infrequently (<30%). 1.0 Protein The frequency of contacts differs depending upon the type of antigen with which the antibody interacts. SDR usage Peptide Hapten 0.5 0.0 H1 H2 H3 Almagro. J. Mol. Recognit. 17:132, ‘04 Contact usage - specificity relationship Anti-protein Anti-peptide Anti-hapten Model to create diversity in the antigen-binding site as a function of the specificity Conclusions I 1. Model to correlate the structure of the antigen binding site with its specificity. 2. Guide for tailoring the antigen-binding site diversity depending upon the type of antigen the antibody interacts with. 4. Design and Validation of Topography-Biased Antibody Libraries VH Repertoire with Tailored Diversity Dp47 scaffold Full diversity: 20 aa + 1 amber codon in positions often found in contact with proteins and peptides R/K All the germline genes have R at this To explore all amino acid variants in position, except dp47 that has K positions with high contact usage Limited Diversity: YDAS (Felluose et al., PNAS 34, 12467, ‘04) To simplify the diversity in positions of medium usage while avoiding stop codons Theoretical diversity: 720 x 94 x 2 = 6.7 x 1014 variants Construction of the VH repertoire The repertoire was synthesized by overlapping PCR (Stemmer et al., Gene. 164:49, ‘95) in a single-step PCR reaction by using 10 internal oligonucleotides and two amplification primers 1 10 20 30 40 50 60 70 80 90 100 110 |...|....|....|....|....|....|....|....|....|....|..a..|....|....|....|....|....|..abc..|....|....|a....|....|....|.. 1 3 5 7 9 Leader |||||||<<<<||||||| |||||||<<<<<<||||||||||||||<<<<<<<<<<||||||| |||||||<<<||||||| |||||||<<<<<||||||| |||||| |<<< LLAAQPAMAEVQLLESGGGLVQPGGSLRLSCAASGFTFOOOOMOWVRQAPGKGLEWVSOIOOOOGOTOYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAOOOOOYFDYWGQGTLVTVSSGGG >>>>>>>>>||||||| |||||||>>>>||||||| |||||||||||||| |||||||>>>>||||||| |||||||>>>||||||| |||||||>|||||| |linker 2 4 6 8 10 D1.3-VL VH repertoire linker pIT * (His)5 Size: 3 x 108 members Validation of the VH repertoire Chimeric library Washed away Trypsin to elute non-bound Ф bound Ф Characterization Selection HEL-coated immunotubes KM13 4.00 Polyclonal ELISA OD (450 nm) D1.3 3.00 Round 1 2.00 Round 2 1.00 0.00 1.00E+10 1.00E+11 1.00E+12 1.00E+13 1.00E+14 Titer (pfu/mL) In Round 2, the ELISA signal was similar to D1.3 displayed on the phage Frequency of scFv’s (hit rate) 2.500 select clones OD (450 nm) 2.000 1.500 1.000 0.500 Grow in 2xTY 0.000 1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 Clone number IPTG Test in ELISA Clone D1.3 JCAV-II-HEL-C6-1 JCAV-II-HEL-E3-1 JCAV-II-HEL-B3-1 JCAV-II-HEL-C7-1 JCAV-II-HEL-F8-1 JCAV-II-HEL-B8-1 JCAV-II-HEL-B7-1 JCAV-II-HEL-F8-2 JCAV-II-HEL-E8-2 JCAV-II-HEL-H6-1 Frequency OD 1 1 1 2 1 2 5 3 1 3 1.230 0.434 0.597 0.597 1.254 1.657 1.779 1.747 1.925 1.984 2.276 H1 30 35 | . . . . | H2 50 55 | . . a . | . . . . H3 100 . | a b c T A Y . . . D S Y . S M S . T Y . Y . G . D R R K . . . . . . . . G A N H G S D K N F T Y S D D . A . A . D D G Y S A S A D A A S A V M . . . . . . . . . N S A A . A . A D . A I I . . . . . . . . . W A Y H G Y G S L G T S . A A . Y A . A A G Y S . S S . S D A D D D Y S S Y Y S S A S G G . . . . . . . . . N A D S D D D D D D D T T . . . . . . . . . D D D D D S A D Y S A E E . . . . . . . . . R D G E K G R M E M R D V A . P A A P A P P Y Y M F Q M T T T L L R Y . . . . . . . . . Expression and relative affinity Relative Scale* 1 0.75 D1.3 HELII-B7 0.5 HELII-H6 0.25 *Relative Scale: 1- (Max-O.D. / Max - Min) 0 1 10 100 1000 Log (Dilution) The chimeric scFvs are 7-9 times better expressed than D1.3 as suggested by the ED50 The affinity for HEL may be similar to D1.3 as suggested by the slope of the curves HEL-D1.3 affinity 5 nM ( Foote and Winter, J. Mol. Biol. 224: 487, ‘92) Conclusions II 1. A VH repertoire with tailored diversity to recognize proteins and peptides was designed and constructed 2. It was cloned with the VL chain chain of D1.3 to yield a chimeric library of 3 x108 members. 3. After the second round of selection on HEL-coated Immunotubes, diverse scFvs against HEL were obtained, thus validating the library as source of VH domains. 4. The scFvs dominating the population are well expressed in E. coli and may have affinities in the nM range. 4. Design and Validation of Topography-Biased Antibody Libraries Topography biased antibody libraries Dp47 scaffold with tailored diversity for proteins and peptides (Almagro et al., J. Mol. Biol. Submitted) Theoretical diversity: 2.1 x 1010 Invariant VL chain with a long L1 Invariant VL chain with a short L1 Invariant VL chains Use Frequency (%) Short L1 Long L1 30 A27 20 10 0 0 5 10 15 20 25 30 35 40 45 Numbering 30 ..|....|abcdef....| A27 CRASQSVSS-----SYLAW | |||| |||| 1-4 (B3)CKSSQSVLYSSNNKNYLAW ||||||||||||||||||| A27md CKSSQSVLYSSNNKNYLAW Human Germline Genes (IGMT) Graft L1 of B3 in A27 The difference between repertoires is reduced to one insertion of 5 amino acids at the tip of L1 and 5 mutations in L1, positions: 28, 29, 30, 30a and 31 Combination with different invariant VL chains linker A27/Jk1 VH repertoire * (His)5 pIT Anti-protein repertoire Size: 3.6 x 108 members Insertion of 5 aminoacids at L1 VH repertoire linker A27/Jk1mod pIT Anti-peptide repertoire * (His)5 Size: 6 x 107 members Panel of Selectors V3 loop gp120 (V3) 14 aa; 1.6 KDa Hen Egg White Lysozyme (HEL) 129 aa; 14.3 KDa Bovine Serum Albumin (BSA) 583 aa; 66.4 KDa V3-BSA conjugate ND Selections conducted as described for VH-D1.3 Polyclonal ELISA after Round 3 V3 selections BSA selections 4.000 O.D. 450 nm O.D. 450 nm 4.000 3.000 2.000 1.000 3.000 2.000 1.000 0.000 0.000 1.0E+07 1.0E+09 1.0E+11 1.0E+13 1.0E+07 1.0E+09 1.0E+11 1.0E+13 Titer (cfu/mL) Titer (cfu/mL) HEL selections 4.000 4.000 3.000 3.000 O.D. 450 nm O.D. 450 nm V3-BSA selections 2.000 1.000 0.000 2.000 1.000 0.000 1.0E+07 1.0E+09 1.0E+11 Titer (cfu/mL) Red: Anti-peptide library 1.0E+13 1.0E+07 1.0E+09 1.0E+11 Titer (cfu/mL) Blue: Anti-protein library 1.0E+13 Frequency of positive clones 91/96 100 select clones Frequency (%) Grow in 2xTY 80 60 40 92/96 LL1 library SL1 library 32/96 64/192 42/192 20 0/96 3/96 0/96 0 IPTG Test in ELISA V3 V3-BSA BSA HEL Anti-peptide library yields more scFvs for V3 and V3-BSA than for proteins Anti-protein library yields more scFvs for proteins than forV3 or V3-BSA Unique scFvs Determined by DNA sequencing Library pep pep pep pep pro pro pro pro Selector V3 V3-BSA BSA HEL V3 V3-BSA BSA HEL Unique / Total 1/6 1/6 2/5 1/3 2/5 2/6 Specificity of unique clones V3 and V3-BSA selections BSA selections 2.000 2.000 SL1-VB1 LL1-B2 LL1-V1 LL1-B1 1.000 1.000 0.000 V3 V3-BSA BSA 0.000 HEL The scFv selected from the anti-peptide lib. on V3 is specific for V3 and V3-BSA V3 V3-BSA BSA HEL HEL selections 2.000 SL1-H1 SL1-H2 The scFv selected from the anti-protein lib. on V3-BSA is specific for the carrier LL1-H1 LL1-H2 1.000 ScFvs selected on proteins are specifics 0.000 V3 V3-BSA BSA HEL Expression and Relative Affinity HEL selections SL1-H1 3.00 SL1-H2 2.50 LL1-H1 2.00 LL1-H2 1.50 D1.3 1.00 0.50 0.00 1 10 100 1000 Different dynamic ranges, better slopes and higher ED50 indicating differences in binding (different epitopes?) ScFvs from SL1 (anti-protein library) look better than the those isolated from LL1 (anti-peptide library) General Conclusions 1. Anti-protein library produced diverse specific scFvs against two protein models: BSA and HEL. 2. Anti-protein library did not produce scFvs against the peptide model, free or conjugated. Only against the carrier. 3. Anti-peptide library produced specific scFvs against the peptide. 4. Anti-peptide library produced less binders against HEL than the anti-protein library. 5. Anti-peptide library did not produce scFvs against BSA and against HEL produced less binders than the anti-protein library. 6. Together, these results suggest that antibody libraries can be biased toward the recognition of different kinds of antigens based on structural principles Acknowledgments Florida International University Alvaro Velandia Matt Osentoski Sylvia L Smith National University of Mexico Luisa Fernadez Alejandra Blancas Enesto Ortiz Baltazar Beceril Lourival Possani Alejandro Alagon This work was supported by: •Grant 1R03AI057752-01 from NIH/NIAID •Sub-Contract DAAD13-03-C-0065 from CBD/USF.