* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Download 3.blast-and-E-values..
Survey
Document related concepts
Transcript
Finding Sequence Similarities There are many programs used to do this. They range from relatively slow programs which find the exact best matching alignment, through ones which take progressively inexact shortcuts to speed things up. Of this latter class, the best known, and easily most widely used is BLAST, developed by Stephen Altschul and others, and continuously refined over the last 10-15 years. The essential idea is to compare your query sequence against a collection or ‘database’ of target sequences, looking for the one(s) that match the query sequence the best. database query >query AGACGAACCTAGCACAAGCGCGTCTGGAAAGACCCGCCAGCTACGGTCACCGAG CTTCTCATTGCTCTTCCTAACAGTGTGATAGGCTAACCGTAATGGCGTTCAGGA GTATTTGGACTGCAATATTGGCCCTCGTTCAAGGGCGCCTACCATCACCCGACG GTCATGCCGGTCCCCAGCAGCTGCTAATAACTTCCTTCGCTACTCAAGTTACCA CGCTAGCAAAACCCACGGCATACCGTTTACCCTTTAAAATCAGCTTCAACCAGC AACGAA COMPARE LIST MATCHES >target1 AAAACAGGAATATTTACCGGGACCGGGTAATGATGCATCTCGAGGTACACAATATACCTG GAGAACCGAATTATGAGTTGGCCACCTTACTTAACGAAACCAGCAGAGAAAATCCAACAT GGCAACACCCCTCTGACTACACTAGAAGGAACTACTATGTAAGAAAACAGCCTGTCCCTT GCAGTTTGAATGACTGGGTGATGCGAAATGGGGGTCCTGCCATAGAGCGCTTCCATGGTT TACCTTGCACATTTCAGAGAAGTCCTATGCCAGGAGTCCTTCCTACAGGGCCTTCCTGAA ACTATATATGTGCTTATTCTTGTTTGATTTGGCTTTGCAG >target2 CTCTTAATTTATTTCTCTTCCTGCAGCTCCCTCGCTTTTTCCTTTCCCTGTTACATTCAT CTGACTTGAAGAGTTGCAAATTTTCAGTGTTTCTGTTTTTGTTGCTGATATGTTGTAAAC TTTTTAATAAAATCTATTTCTATAG >target3 GCAGTTTGAATGACTGGGTGATGCGAAATGGGGGTCCTGCCATAGAGCGCTTCCATGGTT TACCTTGCACATTTCAGAGAAGTCCTATGCCAGGAGTCCTTCCTACAGGGCCTTCCTGAA ACTATATATGTGCTTATTCTTGTTTGATTTGGCTTTGCAGCTAGGGTTTTCACCTTTTCT GGAAAAAAAAATACTGGCTTCC >target4 CTGCTATTAATGGGCAAAACAACTCAAATAAAGTCCCTCTGCCACCCTCAGACACTGCCC CTGGCCCCCAGCTGCCCGCTGATCCTTGTAGCCAGAGCAGTAAAGTTTTGAAAGTGGAGC CCAAGGAGAATAAAGTTATTAAAGAAACTGGCTTTGAACAAGGTGAAAAGTCTTGTGCAG CACCTCTAGATCATACTGTGAAGGAAAATCTTGGACAAACTTCTAAAGAACAGGTGGTAG Flavours of BLAST BLAST can perform a number of similar tasks with different types of sequence: BLASTn – comparing nucleotide sequence vs. nucleotide sequence database - FAST BLASTp – comparing protein sequence vs. protein sequence database - FAST BLASTx – comparing nucleotide sequence vs. protein sequence database by translating the nucleotide sequence in all possible reading frames - SLOW tBLASTn – comparing protein sequence vs. nucleotide sequence database translated into all possible reading frames - SLOWER tBLASTx – comparing nucleotide sequence vs. nucleotide sequence database translating both into all possible reading frames – EXCRUCIATINGLY SLOW! The amino acid sequence based programs use a substitution matrix to allow some amino acids to count as effective matches with each other. These are the BLOSUM and PAM matrices you may see referred to from time to time. How does it work? The main task of any sequence comparison program is to test all possible mutual alignments of two sequence and see how good the match is: query 1st database sequence CCGAGCTTCTCATTGCTCTTCCTAACAGTGTGATAGGCTAACCGTAATGGCGTTC CCGAGCTTCTCATTGCTCTTCCTAACAGTG=TGATAGGCTAACCGTAATGGCGTTC ||||||||||||||||||||||||| |||||||||||||||||||||||| |||||||||||||||||||||||| | || | ||||||||||||||||||||||||| | | | || || || || || || || CTTCTCATTGCTCTTCCTAACAGTGATGATAGGCTAACCGTAATGGCGTTCAGGAGT CTTCTCATTGCTCTTCCTAACAGTGATGATAGGCTAACCGTAATGGCGTTCAGGAGT CTTCTCATTGCTCTTCCTAACAGTGATGATAGGCTAACCGTAATGGCGTTCAGGAGT BLAST achieves its speed through two strategies: It ‘indexes’ the database sequences so it know where all the minor subsequences are in each sequence, so it doesn’t have to look all the way through each sequence each time, letter by letter. It’s ‘word based’, so that it will only start looking for possible extensive alignments once it’s found a seed alignment of an exact match. The default seed lengths are 11 letters for BLASTn and 3 for BLASTp. This means that some good alignments are un-findable, e.g. a 50% protein match with exactly every second amino acid matching. It relies on these ‘uniformly distributed’ alignments being very rare occurrences. BLAST –Typical Output INPUT: >partial cDNA sequence, Xenopus tropicalis CGGAGCTCAGGCCTCACCGGCGGACATGTCCGGGAAAATAGAGAAAGCAGACAGCCAGCGTTCCCACCTCTCCTCTTTCACCATGAAGCTCAAGGACAAATTCCACTCCC CCAAAATCAAGCGCACCCCGTCCAAGAAGGGGAAGCCGGCCGACCTCACCGTCAAAACAGAAGAGAAACCCGTCAACAAAACCTTAAGCCGCTTGGAGGAACAGGAGAAA GAAGTCGTTAATGCCTTGCGTTACTTTAAGACAATTGTTGACAAGATGGCGGTGGACAAGATGGTGCTGGTGATGCTGCCAGGGTCGGCGA OUTPUT: Query= (311 letters) Database: NCBI Protein Reference Sequences 954,378 sequences; 347,895,532 total letters >gi|41055060|ref|NP_957420.1| similar to guanine nucleotide-releasing factor 2 (specific for crk proto-oncogene) [Danio rerio] Length=691 Score Expect Identities Positives Gaps Frame Query Sbjct = = = = = = 133 bits (335) 6e-31 76/98 (77%) 82/98 (83%) 4/98 (4%) +2 26 MSGKIE-KADSQRSHLSSFTMKLKDKFHSPKIKRTPSKKGKPA--DLTVKTEEKPVNKTL 196 MSGKIE K +SQ+SHLSSFTMKL KFHSPKIKRTPSKKGK + VKT EKPVNK + 1 MSGKIESKHESQKSHLSSFTMKLM-KFHSPKIKRTPSKKGKQLQPEPAVKTPEKPVNKKV 59 Query 197 SRLEEQEKEVVNALRYFKTIVDKMAVDKMVLVMLPGSA 310 SRLEEQEK+VV+ALRYFKTIVDKM VD VL MLPGSA Sbjct 60 SRLEEQEKDVVSALRYFKTIVDKMNVDTKVLQMLPGSA 97 When is a match significant? Here is a ‘typical’ weak alignment from BLASTp: RF---KISDCQHPCTYSH-NQYMTNHMREC----PYNGAATSIPSWHLIVHPSNGQSVSFPQSDPCQIKMNQNLHLVQMMYDMQTTHV F K S+ + C + + N Y N +C P+ + +W +P + D I N M ++ NFSWKKTSEKETNCQFDYPNDY--NEQTQCQPMTPFKADVFDLWNWEFNANPKLENGIRDLIDDKHDILQIFN------MCWLEVNSS In fact the sequences were randomly generated, so there is no biologically significant alignment… RFKISDCQHPCTYSHNQYMTNHMRECPYNGAATSIPSWHLIVHPSNGQSVSFPQSDPCQIKMNQNLHLVQMMYDMQTTHV NFSWKKTSEKETNCQFDYPNDYNEQTQCQPMTPFKADVFDLWNWEFNANPKLENGIRDLIDDKHDILQIFNMCWLEVNSS E-values The number of matches like the discovered match that I would expect to find by chance. An E-value of 0.0 implies that I would expect no matches like this to arise by chance, therefore… An E-value of 1 implies I would expect 1 match like this to arise by chance, so if I have a match with such an E-value… E-values From First Principles Notation: 1.2e-35 = 1.2 x 10-35 4.8 x 106 = 4,800,000 Some database statistics (23rd July 2005): Database: NCBI RefSeq mRNA 272,619 sequences; 503,566,580 total letters (~5.0 x 108) Database: NCBI nr 3,329,110 sequences; 14,601,814,750 total letters (~1.4 x 1010) We will consider first searching a nucleotide sequence (‘ACGTAGACGT’) against a nucleotide database, e.g. the RefSeq mRNA above. Then we will consider the more complex case of amino acid sequence (protein) searches. Which is of course what we mostly do. Calculating an E-value The RefSeq mRNA database has ~ 5.0 x 108 letters There are 4 possible nucleotides - ACGT How many matches do we expect to find by chance? Query = ‘A’ CCGCCAGCTACGGTCACCGAGCTTCTCATTGCTCTTCCTAACAGTGTGATAGGCTAACCGTAATGGCG A A A A A AA A A A AA AA Expected number of matches = (5.0 x 108) / 4 = ~1.2 x 108 Query = ‘AC’ CCGCCAGCTACGGTCACCGAGCTTCTCATTGCTCTTCCTAACAGTGTGATAGGCTAACCGTAATGGCG AC AC AC AC Expected number of matches = (5.0 x 108) / (4x 4) = ~3.1 x 107 Query = ‘ACG’ CCGCCAGCTACGGTCACCGAGCTTCTCATTGCTCTTCCTAACAGTGTGATAGGCTAACCGTAATGGCG ACG Expected number of matches = (5.0 x 108) / (4 x 4 x 4) = ~8.1 x 106 Query = ‘ACGTCGA…..CTGATTCG’ - 60-mer Expected number of matches = (5.0 x 108) / (4 x 4 x 4 x 4 … 60 times ) = (5.0 x 108) / 1036 = 5.0 x 10-28 E-value = 5.0 x 10-28 E-values In Practice So if I take a 60 nt sequence: >sequence ACAGCTCGTCCTCCTTCCGAGCCTACCGGGCCGCCCTCTCGGAGGTGGAACCGCCGTGCA and actually BLAST it against the RefSeq mRNA database, I get: BLAST OUTPUT: >gi|27469838|gb|BC041710.1| Homo sapiens Rap guanine nucleotide exchange factor (GEF) 1, transcript variant 2, mRNA (cDNA clone MGC:49019 IMAGE:6051007), complete cds Length=6060 -28 - !? Score = 119 bits (60), Expect = 2e-26 theoretical value was 5.0e Identities = 60/60 (100%), Gaps = 0/60 (0%) Strand=Plus/Plus Query 1 ACAGCTCGTCCTCCTTCCGAGCCTACCGGGCCGCCCTCTCGGAGGTGGAACCGCCGTGCA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 2977 ACAGCTCGTCCTCCTTCCGAGCCTACCGGGCCGCCCTCTCGGAGGTGGAACCGCCGTGCA 3036 What do I get if I BLAST it against the larger nr database? BLAST OUTPUT: >gi|27469838|gb|BC041710.1| Homo sapiens Rap guanine nucleotide exchange factor (GEF) 1, transcript variant 2, mRNA (cDNA clone MGC:49019 IMAGE:6051007), complete cds Length=6060 Score = 119 bits (60), Expect = 6e-25 Identities = 60/60 (100%), Gaps = 0/60 (0%) Strand=Plus/Plus Query 1 ACAGCTCGTCCTCCTTCCGAGCCTACCGGGCCGCCCTCTCGGAGGTGGAACCGCCGTGCA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 2977 ACAGCTCGTCCTCCTTCCGAGCCTACCGGGCCGCCCTCTCGGAGGTGGAACCGCCGTGCA 3036 E-values: Effect of Database Size The nr mRNA database has ~ 1.4 x 1010 letters There are 4 possible nucleotides - ACGT How many matches do we expect to find by chance? Query = ‘A’ CCGCCAGCTACGGTCACCGAGCTTCTCATTGCTCTTCCTAACAGTGTGATAGGCTAACCGTAATGGCG A A A A A AA A A A AA AA Expected number of matches = (1.4 x 1010) / 4 = ~1.2 x 108 Query = ‘AC’ CCGCCAGCTACGGTCACCGAGCTTCTCATTGCTCTTCCTAACAGTGTGATAGGCTAACCGTAATGGCG AC AC AC AC Expected number of matches = (1.4 x 1010) / (4x 4) = ~3.1 x 107 Query = ‘ACG’ CCGCCAGCTACGGTCACCGAGCTTCTCATTGCTCTTCCTAACAGTGTGATAGGCTAACCGTAATGGCG ACG Expected number of matches = (1.4 x 1010) / (4 x 4 x 4) = ~8.1 x 106 Query = ‘ACGTCGA…..CTGATTCG’ - 60-mer Expected number of matches = (1.4 x 1010) / (4 x 4 x 4 x 4 … 60 times ) = (1.4 x 1010) / 1036 = 1.4 x 10-26 E-value = 1.4 x 10-26 E-values: Effect of Database Size 5.0 x108 letters 1.4 x 1010 letters RefSeq 30 x bigger nr E-value = 5.0e-28 BLAST the same sequence against each E-value = 1.4e-26 The database was ~30 times bigger and so the E-value was ~30 times bigger. The E-value is simply dependent on database size. Why were the values different? Our calculated E-value for searching against the RefSeq mRNA database was 5.0 x 10-28. But our actual BLAST search at NCBI gave a value of 2.0 x 10-26 - about 40x larger - why is this? Gapped alignments If we were expecting N matches for a query sequence ‘ACGTACGTACGT’, imagine what would happen to N if we allowed gaps in our matches. ACGTAC?GTACGT This would now give us additional possible alignments that would meet our ‘match’ criteria: ACGTACGTACGT |||||||||||| ACGTACGTACGT ACGTACAGTACGT |||||| |||||| ACGTAC-GTACGT ACGTACCGTACGT |||||| |||||| ACGTAC-GTACGT etc. We will expect many more matches in a given database, if we allow our alignments to have gaps. The E-value will be larger. E-values: Effect of Query Length BLAST 500 nt sequence against a database >sequence ACTAGTCTAGCTAGACATCG ATCGATGATGCTACACAGAT AGACGATAGATAGTAAGTCG ATCGATCGCGCATCGATCGT CTAGATCGATCGCTCGCTGT GTAGATAGATCGGCGATAGA BLASTn database Get a full length match with sequence XYZ at an E-value = 5.0e-160 BLAST half of the same sequence against the same database >sequence ACTAGTCTAGCTAGACATCG ATCGATGATGCTACACAGAT AGACGATAGATAGTAAGTCG BLASTn database Get a match with sequence XYZ again, but at an E-value = 5.0e-80 Biologically it’s the same match! Does it mean we are any less sure that this match didn’t occur by chance? The E-value is simply dependent on match length. Why not just use % identity? At some levels this a good question. But consider two very different searches, both of which give a 75% identity match Query1 was 60 nt long: CGGAGCTCAGGGCTTAACGACTGATATCTCCGCGCATGTCGAGAAACGATACAGCCAGCG ||||||||||| || | || | || || |||| | | | |||||| | |||||||||| CGGAGCTCAGGCCTCACCGGCGGACATGTCCGGGAAAATAGAGAAAGCAGACAGCCAGCG Which would have an E-value ~ 5.0 x 10-19 And, Query2 only 16 nt long: ACGTACGTACGTACGT ||| || | |||| || ACGCACCTTCGTAGGT Which would have an E-value ~ 30 And intuitively we feel we would expect to see that sort of number of matches in the database just by chance… So what’s the real problem? Basically you are usually trying to answer the question: Can I find the ortholog of my gene in some other species, so that I can work out what it might be doing in my organism? And the difficulty is because BLAST does not set out to address questions like orthology. BLAST only tells you about sequence similarity, with some notion of how likely a similarity is to have arisen by chance, based on some general biological principles. You will always have to add in your own knowledge of biology, and exactly what your query sequence was, and how it is related to your matching sequences. In particular whether the degree of similarity matches up to the supposed evolutionary distance between the two species. You will also need to take into account the length of the reported match, compared to the lengths of your query and matched sequences. And of course the size of the database. Are there any useful guidelines though? Rules of Thumb How good does an E-value have to be before we might even think we have an ortholog? larger/worse E-values 10-5 10-10 smaller/better 10-40 10-100 0.0 fantasy borderline encouraging pretty good can’t get better But note that in some gene families with closely related members you can get an E-value of 0.0 for several different matches, and then % identity may be more sensitive. Also bear in mind, in cases like this, that ideas of ‘functional’ orthology may break down, with more than one locus producing identical proteins which share the same function… Protein BLAST It’s (nearly) always better to make comparisons at the amino acid level between protein sequences than the DNA level, because there are many different DNA sequences that can give exactly the same protein sequence. Does this cause us to treat expected values any differently? If we follow the argument as before then for an exact match of a 20 amino acid sequence in the RefSeq protein database, each additional amino acid will reduce the E-value by 1/20th (there are 20 different amino acids). And as there are 347,895,532 letters in that database, E-value = ~3.5 x 108 / (20 x 20 x 20 …20 times) = ~3.5 x 10-18. But this is what we get of we run the blast at NCBI: Score = 43.1 bits (100), Expect = 8e-04 Identities = 20/20 (100%), Positives = 20/20 (100%), Gaps = 0/20 (0%) Frame = +3 Query 3 Sbjct 972 SSSSFRAYRAALSEVEPPCI SSSSFRAYRAALSEVEPPCI SSSSFRAYRAALSEVEPPCI 62 991 Really too big a discrepancy to easily explain with hand waving… Amino Acid Substitutions In fact we need to take into account both amino acid substitutability, as well as, as before, allowing gapped alignments. On average any residue can be substituted for by about 2 others, so each position has about 1/7th chance of ‘matching’ rather than 1/20th. A C F G I L M P V W S LWY LMV IMFV ILV ILM FY N Q S T Y DHS REHK ANT S HFW H K R NQY RQE QK D E NE DQK So now we get: E-value = ~3.5 x 108 / (7 x 7 x 7 …20 times) = ~4.4 x 10-9, which is much closer to the actual BLAST value. Exercises Go to the file random-DNA-sequences.html, randomly select one of the 20 randomly generated nucleotide sequences, and do a BLASTx (translated DNA->protein) at NCBI against the nr protein database. Did you find any ‘significant’ hits? Repeat with a second sequence. What conclusions might you draw from this exercise? Try the same sequence(s) against the nr nucleotide database. Is there any general difference?