Survey
* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Some powerpoint slides shown during CHEM 641 class 9/12/07 Primary sequence Human hemoglobin beta-subunit (FASTA format) >gi|4504349|ref|NP_000509.1| beta globin [Homo sapiens] MVHLTPEEKSAVTALWGKVNVDEVGEALGRLLVVY PWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLG AFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRL LGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVAN ALAHKYH Primary Sequence Secondary Structure -helix -helix double headed arrows indicate hydrogen bonds H O N O C N R H R H C N O O R H C N C N R H O R H O C N O C N R H R H C N O O C C N R H anti-parallel -sheet H O N N-term C N R H R H C O C N R H R N C O O H R O H R O N C N H C C-term C N C N N R C O O H R O H R parallel -sheet H O N N-term C N R H H O N N-term C N R H R H C N O R H C N O O C N R H O C N R H R H C N O C O R H N O C O C-term R C R R C-term Secondary Structure Tertiary Structure Tertiary Structure Quaternary Structure ht-ADH from B. stearothermophilus is a homotetramer Hemoglobin and Myoglobin Quaternary Structure Hb 22-heterotetramer Mb – single subunit (tertiary structure only) Click picture to right for Hb dynamics movie Classes of Globular Protein Folds 1) Anti-parallel -helix 2) Parallel -sheet -- motif 3) Anti-parallel b-sheet 4) Metal / disulfide rich