Survey
* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Printed in Great Britain Microbiology (1996), 142,741-746 Two multifunctional peptide synthetases and an 0-methyltransferaseare involved in the biosynthesis of the DNA-binding antibiotic and antitumour agent saframycin M x l from Myxococcus xanthus Andreas Pospiech, Jurg Bietenhader and Thomas Schupp Author for correspondence: Andreas Pospiech. Tel: +41 61 6961746. Fax: +41 61 6966323. Ciba-Geigy Ltd, Core Drug Discovery Technologies, CH-4002 Basel, Switzerland Saframycin M x l is a DNA-binding antibiotic and antitumour agent produced by Myxococcus xanthus. It is a heterocyclic quinone, thought to be synthesized via the linear pepide intermediate AlaGlyTyrTyr. Analysis of 14-1kb DNA sequence involved in saframycin production revealed genes for two large multifunctional peptide synthetases of 1770 and 2605 amino acids, respectively, and a putative 0-methyltransferase of 220 amino acids. The three ORFs read in the same direction and are separated by short non-translated gaps of 4 4 and 49 bp. The peptide synthetases contain two amino-acid-activating domains each. The first domain lacks two of the most conserved 'core' sequences, and the last domain is followed by a putative reductase functionality, not previously seen in peptide synthetases. Complementation tests showed that antibiotic-nonproducing mutant strains lacking one of the peptide synthetases secrete a substrate, presumably a modified amino acid precursor, that can be used by 0-methyltransferase-def icient mutant strains to synthesize saframycin M x l . Keywords : Myxococcus xanthus, saframycin Mxl , antibiotic, peptide synthetase, 0methy ltransferase INTRODUCTION OCH,A I The Gram-negative myxobacteria grow in soil and have a complex life cycle with multicellular differentiation. Simiar to differentiating actinomycetes and bacilli, they produce a large number of secondary metabolites (Reichenbach e t al. , 1988). Myxococczts xantbzts produces saframycin Mxl (Irschick e t al., l988), a heterocyclic quinone antibiotic which has antibacterial and antitumour activity. Other saframycins were isolated from Streptomyces lavendztlae (Arai et al., 1977, 1980). The saframycins bind covalently to DNA and inhibit DNA and RNA synthesis (Ishiguro et al., 1978, 1981 ; Kishi e t al., 1984; Lown e t al., 1982). The N-heterocyclic quinone of saframycin Mxl (Fig. 1) is derived from two tyrosine molecules, and the side chain is derived from glycine and alanine (Trowitzsch-Kienast e t al., 1988). ACH, ACH,O I Previously we identified, by T n 5 mutagenesis in M. The GenBank accession number for the sequence reported in this paper is U24657 0002-0658 0 1996 SGM Ala Fig. 7. Structure o f saframycin Mxl derived from alanine, glycine and two tyrosines. Filled triangles indicate methylations. Downloaded from www.microbiologyresearch.org by IP: 88.99.165.207 On: Sun, 18 Jun 2017 14:40:59 741 A. POSPIECH, J. B I E T E N H A D E R a n d T. SCHUPP xantbzu, genes involved in saframycin Mxl biosynthesis. The corresponding DNA was cloned in Escbericbia coli on overlapping cosmids. Fragments of the cloned DNA were used to create saframycin-non-producing derivatives by gene disruption, confirming the identity of the cloned genes and localizing them on the cosmids. Sequencing of part of an open reading frame revealed a putative peptide synthetase, suggesting that saframycin Mxl may be derived from a non-ribosomally synthesized peptide precursor (Pospiech e t a/., 1995). Here we describe a more detailed analysis of the saframycin Mxl biosynthetic gene cluster, which possesses some novel features. METHODS Strains, plasmids and culture conditions. The bacterial strains and plasmids used are listed in Table 1. E . coli was grown at 37 "C in Luria broth (LB) or on LB agar. Sarcina lutea was grown at 30 "C on solid DST medium (Oxoid) or in liquid BHI medium (BBL). M . xanthus was grown at 28 "C in S45 medium (Pospiech e t al., 1995), or on solid S46 medium, which is S45 with 12 g agar 1-'. Antibiotics were used at the following concentrations for E . coli and M. xanthus: 50 pg ampicillin ml-', 50 pg kanamycin ml-' and 34 pg chloramphenicol m1-l. DNA manipulations. Standard genetic techniques for in vitro DNA manipulations and cloning were used (Sambrook e t al., 1989). PCR amplification. A 519 bp fragment internal to ORF C was amplified using the primers 5'-ATGAATTCACGTCGAATTGACACAGTCC and 5'-ATGAATTCACAGCGTGTTGTCGAGGATG 3' (the non-homologous tails containing EcoRI sites are underlined), and pAP93/8 (Pospiech e t al., 1995) as template. Reaction buffer and Tag polymerase from Boehringer Mannheim were used. Thirty cycles of 30 s at 96 "C, 1 min at 55 "C, 1 min at 72 "C were performed in a Hybaid thermocycler (MWG-Biotech). Gene disruption of M. xanthus DM504/15. pAP107-10 was introduced into M . xanthus DM504/15 by conjugation from E. coli. An overnight culture of E. coli S17-1 containing pAP10710, grown under kanamycin and ampicillin selection, was diluted 100-fold with LB medium without antibiotics and incubated for a further 6 h. Subsequently 1 x lo1' cells of this E. coli culture and 5 x lo8 cells of M. xanthzis DM504/15 (grown at 28 OC to a cell density of 2 x lo8 ml-' and preincubated for 10 min at 45 "C) were mixed, sedimented (SOOOg, 3 min), resuspended in 150 pl S45 medium and spotted onto S46 agar without antibiotics. After overnight incubation at 28 "C, cells were scraped off the agar and resuspended in 1 ml S45 medium. Portions (100 pl) were plated onto S46 plates containing 50 pg kanamycin ml-' and incubated for 6 d at 28 "C. Kanamycinresistant transconjugants, containing plasmids integrated into the genome via homologous recombination, were selected. Biological assay (biotest) for saframycin M x l production. M. xanthus DM504/15 and its derivatives were grown for 5 d at 28 "C on S46 agar (20 ml per plate) without antibiotics. Agar plugs (3 mm in diameter) with single colonies were placed onto DST agar freshly overlaid with 10 ml 45 "C DST agar containing 100 pl of an overnight culture of Sarcina lutea. After overnight incubation at 30 "C, the inhibition zones of S. lutea were measured. This biological assay detected b 0.5 ng saframycin Mxl. Colonies of strain DM504/15 produce 10-25 ng saframycin Mxl and inhibition zones of 10-14 mm diameter; non-producing mutants did not inhibit the growth of S.htea. Complementation test. M. xanthus mutant strains were grown for 3 d at 28 "C in S45 medium without antibiotics. Subse- Table 1. Bacterial strains and plasmids Strain or plasmid E. coli XL1-Blue S17-1 M y xococcus xanthus DM504/15 APlO9-2 AP100/1-1 AP100/6-1 Sarcina lutea ATCC 9341 Plasmids PAP107-10 pCIBl32* pBluescript I1 SK' Characteristicst Source or reference recA 1 endA 1 g y r A 9 6 tbi- 1 bsdR 17 supE44 r e l A 1 lac [F' proA+B+ facIq AfacZM15 Tn 10 (Tc')] recA pro tbi bsdR chr :: RP4-2 Stratagene Cloning Systems Saframycin Mxl production strain DM504/15, safC: :pAP107-10, Saf Km' DM504/15, s a p ::pAP98-1, Saf Km' DM504/15, s a f A : :pAP98-17, Saf- Km' Pospiech e t al. (1995) This study Pospiech et al. (1995) Pospiech e t al. (1995) Saframycin Mxl sensitive American Type Culture Collection 0.5 kbp internal PCR amplified fragment of sajC cloned in the EcoRI site of pCIB132 Amp' Cm' Km' oriT (RK2) Amp' This study Simon e t al. (1986, 1983) J. M. Ligon, pers. comm.$ Stratagene Cloning Systems * Derivative of pSUP2021 (Simon et al., 1986) constructed by reversal of the 5 kb Not1 fragment, followed by removal of the resulting 3 kb BamHI fragment, leaving a unique BamHI cloning site. t Saf+'-, saframycin productionlnon-production. $ J. M. Ligon; Ciba-Geigy Corp., PO Box 12257, Research Triangle Park, NC 27709-2257, USA. 742 Downloaded from www.microbiologyresearch.org by IP: 88.99.165.207 On: Sun, 18 Jun 2017 14:40:59 Saframycin Mxl biosynthesis in M . xanthtrs quently they were mixed (5 pl from each strain), spotted onto S46 agar and incubated for a further 2 d at 28 "C. Agar plugs (3 mm in diameter) were then placed onto DST agar freshly overlaid with 10 ml molten (45 "C) DST agar and 100 p1 of an overnight culture of S. lutea. After overnight incubation at 30 "C, the inhibition zones of S.Iutea were measured. HPLC analysis of saframycin Mxl production. S45 medium (20 ml) was inoculated with 1 ml cells from a -70 "C stock in 20 % (v/v) glycerol and incubated with shaking for 3 d at 28 "C. Then a second preculture in 20 ml S45 medium was inoculated with 5 YOof the first culture and incubated with shaking for 3 d at 28 "C, after which 1.5 ml of the second culture was transferred to a 200 ml Erlenmeyer flask containing 50 ml Saf3 medium [containing, per litre: 3 g casein peptone, 32 g dextrin A-332, 2 g MgSO, .7H,O, 0.5 g CaC1,. 2H,O, 4 g sodium citrate, 50 g absorber resin XAD 1180 (Rohm and Hass), pH 7.21. After 3 d shaking at 28 "C, 5 ml 5 % (w/v) casitone was added. After additional incubation for 3 d at 28 "C the absorber resin XAD 1180 was harvested on a polyester sieve (Satorius, B 420-47-N) and eluted with 20 ml 90% (v/v) 2-propanol by shaking for 30 min in 50 ml Falcon tubes at room temperature. The 2propanol eluate was centifuged for 5 min and the clear supernatant was analysed by HPLC for its saframycin Mxl content. For reverse-phase HPLC analysis, the silica-based stationary phase Lichrospher 60 A RP-18 (5 pm; Merck) was used in a 12.5 cm column. A potassium phosphate buffer (2.5 mM, pH 3) acetonitrile gradient was the mobile phase. Saframycin Mxl was detected by absorption at 260 nm. Yields for strain DM504/15 were between 18 and 24 mg (1 culture)-'. The detection limit was 3 mg 1-'. DNA sequencing. Double-stranded D N A fragments were cloned into pBluescript I1 SI<' and both strands were examined by DNA cycle sequencing with dye-labelled terminators (Sanger et al., 1977) and an Applied Biosystems automated sequencer (model 373A). Universal primer and oligonucleotide primers designed according to the newly obtained D N A sequences were used. The standard cycling conditions were 25 cycles of 96 "C for 20 s and 60 "C for 240 s. All reactions were performed in a Perkin-Elmer GeneAmp 9600 PCR system using the AmpliTaq DNA polymerase from Perkin-Elmer. Computer analysis of DNA and protein sequences. The D N A sequences were assembled and analysed using software version 1.20 from Applied Biosystems and the UWGCG program package version 8.0 (Devereux e t al., 1984). RESULTS AND DISCUSSION Sequence of three ORFs involved in saframycin M x l biosynthesis The sequence of saframycin biosynthesis genes was extended in both directions to cover 14.1 kb of DNA with an overall G C content of 71 mol YO,typical for myxobacteria. Three ORFs with a codon usage typical for highG + C genes were identified using the program CODONPREFERENCE (Fig. 2). The three ORFs read in the same direction and are separated by short, presumably untranslated, regions of 44 and 49 bp (Fig. 2). Each ORF is preceded by potential ribosome-binding sites upstream of the ATG start codons (Table 2). Promoter sequences are not evident from the sequence; no consensus promotor sequence has yet been established for M~yxococcz~s. Two very large ORFs encode the putative peptide synthetases SafA (2605 amino acids, M,285745) + kb - AP 100/1-1 1 B BE E 4% AP10016-1 p & , safB B B @ . APx9-2 p B & , , 6 @ B B +@& +@ safA safC Fig. 2. Organization of the saframycin Mxl biosynthesis gene cluster of M. xanthus DM504/15. Open boxes in ORF A (safA) and ORF B (safB) show the amino-acid-activating domains. Exact amino acid positions of domains are indicated by the numbers above. The black bars indicate DNA fragments whose integration into the DM504/15 genome abolishes saframycin M x l production. Filled triangles indicate the positions of Tn5 insertions. The complete sequence is available under GenBank accession number U24657. Nucleotide positions of the start and stop codons: safA, 5491-13305; safB, 138-5447; safC, 13354-14013. E, EcoRl; B, BamHI. and SafB (1770 amino acids, M, 192495) and the downstream ORF encodes a putative O-methyltransferase, SafC (220 amino acids, M,24673). Putative peptide synthetases SafA and SafB Both SafA and SafB contain two domains of approximately 520-600 amino acids resembling amino-acidactivating domains of known peptide synthetases. Highly conserved 'core' sequences, defined by Stachelhaus & Marahiel (1995), are clearly recognizable in all four domains (Fig. 3). The domain SafBl is unusual in that it lacks core sequence 5 (ATP-binding ; Pavela-Vrancic e t al., 1994a, b ; Tohika e t al., 1993), has a poorly conserved core sequence 1 (unknown function) and has an unusually large spacing between the core sequences 1, 2 and 3 (Fig. 3). The core sequences 2, 3 (ATP-binding ; Gocht & Marahiel, 1994), 4 (ATPase motif; Gocht & Marahiel, 1994) and 6 (4'phosphopantetheine binding, D'Souza e t al., 1993; Schlumbohm e t al., 1991 ; Vollenbroich e t al., 1993; Stein e t a/., 1994) are, however, well conserved. Safl3l also contains a spacer motif, HHIVVDFW (unknown function; aa 838-845), downstream of core sequence 6. Spacer motifs are present at the ends of amino-acid-activating domains of the modules initiating peptide synthesis of gramicidin (GrsA) and tyrocidin (TycA) (Hori e t al., 1989; Stachelhaus e t al., 1995; Weckermann e t al., 1988). Therefore, SafB1, the first domain in the sequence, probably activates alanine, the first amino acid in the putative saframycin precursor peptide. The poor conservation or lack of core sequences 1 and 5 is unusual for peptide synthetases, but the related adenylate-forming enzymes also lack strict conservation of these sequences (Marahiel, 1992). Safl32, SafAl and SafA2 contain all six core sequences. A spacer motif is located upstream of SafAl (aa 165-172), the normal position for peptide synthetases not initiating a peptide chain (Stachelhaus e t al., 1995). Downstream of SafA2, without an intervening spacer sequence, are 370 Downloaded from www.microbiologyresearch.org by IP: 88.99.165.207 On: Sun, 18 Jun 2017 14:40:59 743 ' A. P O S P I E C H , J. B I E T E N H A D E R a n d T. S C H U P P Table 2. Putative Shine-Dalgarno sequences * Numbers ORF SD 5aP safA safC GAGG GGAGAAGA GGAAGA Spacer -10-5-5- Start codon* Stop codon* ATG (138) ATG (5491) ATG (13354) TAG (5450) TGA (13308) TAG (14016) in parentheses indicate the first and last nucleotides shown. core sequences LKAQQA 3 SOTTQ Function unknown ATP binding 1 3 4 OELC IGO TQD 5 RIEXEIB ATPase motif ATP binding ATP binding 6 LOOHS 4'phosphopantetheine binding SafBl 97 SafB2 1247 SafAl 559 SafA2 1668 TycA 98 GrsA 111 GrsB-A 540 SrfAl 532 Figrn3. Conserved protein sequences in the domains SafB1, SafB2, SafAl and SafA2, and their comparison with presumably homologous sequences from other organisms. GrsA, gramicidin S synthethase I of Bacillus brevis (Hori e t a/., 1989); GrsB-A, gramicidin S synthethase II of B. brevis (Turgay e t a/., 1992); TycA, phenylalanine-activating enzyme in tyrocidine biosynthesis (Weckermann et a/., 1988); SrfA, surfactin synthetase (Cosmina e t a/., 1993). Perfectly conserved amino acids are printed in bold. The numbers on the left give the positions of the first amino acids shown; numbers between the amino acids indicate the distances between these sequences. The core sequences were defined by Stachelhaus & Marahiel (1995). SafA3 (2216) HetM (130) E q A 2 (3051) Lys2 (967) ANYLAPSSLLTGATGYLGAAFLLEQLLKRTRAT PVTQPKKVFLTGGTGFLGAFLIRELLQQTQADV YAVPGGTILVTGGTAGLGAEVARWLAGRGAEHL EGKTTINVFVTGVTGFLGSYILADLLGRSPKNY Fig. 4. Alignment of a putative NAD(P)H-bindingsite of SafA3 with those from other proteins. HetM, putative polyketide synthetase from Anabaena sp. (Black & Wolk, 1994); EryAZ, pketoreductase domain of the polyketide synthetase involved in erythromycin biosynthesis of Saccharopolyspora erythraea (Donadio & Katz, 1992); Lys2, a-aminoadipate reductase of Saccharomyces cerevisiae (Morris & links-Robinson, 1991). The numbers in parentheses give the positions of the first amino acids shown. Perfectly conserved amino acids are shown in bold. amino acids similar to the ketoreductase function of HetM, a putative polyketide synthase of Anabaenaf sp. (44% identity; Black & Wolk, 1994) and Lys2 of SaccharomJyces cereuisiae, which reduces a-aminoadipate to a-aminoadipic-d-semialdehyde using N ADPH (33 YO identity ; Morris & Jinks-Robertson, 1991). SafA2, HetM and Lys2 contain an NAD(P)H binding motif (Fig. 4) characteristic for diverse reductive enzymes. SafA2 is the first peptide synthetase amino-acid-activating domain with a putative reductase function but interestingly, Lys2 contains all six peptide synthetase core sequences in the correct order upstream of the NAD(P)H-binding motif, but with a different spacing (Morris & Jinks-Robertson, 1991). 744 SafC MIHHVELTQSVLQYIRDSSVRDNTlILRDLREETSKLP.LRTMQ1PPEQGQ4 9 MdmC VADQTTLSPALLDYARSVALREDGLLRELIiDMTAQLPGGRAMQIMPEEAQ50 . . ... . I . . . : / : I I . . : l : : : : l l : [ : : I . . I I I . I ) ) II::I S a f C LLSLLVRLI STLCAALALPADGRVIACDLSEEWVSI 9 9 MdmC STLCKARALPAGGRIVTCDISDKWPGI 1 0 0 III I I IIll:I l::-ll:l:.l-:l FLGLLIRL S a f C ARRYWQRAGVADRIEVRLGDAHHSLEALVGSEHR : .:IIIIII.: ~ : : : . I~ ..[ : . :~ : ~ ~ MdmC GAPFWQRAGVDGLIDLRIGDAARTLAELRERDG S a f C FYY SGKVADPSWGDPETDSLRRINAKLLT 1 9 9 MdmC HYY FFGRVADPA.ADDPDTVAVRTLNDLLRD 1 9 9 II S a f C DERVDLSMLPIADGLTLARKR 220 IIIII:.:I.:III:IIII:I MdmC DERVDIALLTVADGITLARRR 220 Fig. 5. Alignment of SafC and the 0-methyltransferase MdmC of Streptomyces mycarofaciens (Hara & Hutchinson, 1992). Shadowed regions indicate conserved sequence motifs in Sadenosylmethionine-dependent methyltransferases. The putative 0-methyltransferase SafC SafC shows 51 Yo identity over its entire length to the 0methyltransferase MdmC of the midecamycin producer Streptomyes mycarofaciens (Fig. 5) (Hara & Hutchinson, 1992) and 39.5 YO identity to the caffeoyl-CoA-3-0methyltransferase (cCoAMT) of Petrosilinum crispum (Schmitt e t al., 1991). Three highly conserved motifs of S-adenosylmethionine-dependentmethyltransferases Downloaded from www.microbiologyresearch.org by IP: 88.99.165.207 On: Sun, 18 Jun 2017 14:40:59 Saframycin Mxl biosynthesis in M . xanthtcs Motif I SafC cCoAMT EryG MdmC 63 TLEVGVFTG 77 TMEIGVYTG 85 VLDVGFGLG 64 VLEIGTFTG Motif I1 134 149 149 135 Motif I11 GTFDLAFI 158 GTFDFVFV 173 ETFDRVTS 176 GAFDLVFV 159 LVRPGGLIIL LVKIGGLIGY VLKPGGVLAI LVRPGGLVAI Fig, 6. Conserved sequence motifs I, II and Ill in Sadenosylmethionine-dependent methyltransferases (Kagan & Clarke, 1994). cCoAMT, caffeoyl-CoA-3-O-methyitransferase o f Petrosilinum crispum (Schmitt et a/., 1991); EryG, erythromycin biosynthesis O-methyltransferase o f S. erythraea (Weber et a/., 1 989); M d mC, midecamycin-O-methy Itra nsferase of Streptomyces mycarofaciens (Hara & Hutchinson, 1992). (Kagan & Clarke, 1994) are also present in SafC (Fig. 6). Due to its high degree of similarity to S-adenosyldependent O-methyltransferases, SafC can be grouped in a class of enzymes catalysing O-methylations of small molecules (Kagan & Clarke, 1994) and may be responsible for one, two or all three O-methylation reactions necessary for the biosynthesis of saframycin Mxl (Fig. 1). Targeted disruption of the genes encoding SafA, SafB and SafC Four amino-acid-activating domains, reductive and methylase functions are consistent with the structure of saframycin Mxl. Further confirmation for the involvement of SafA, Sam and SafC in saframycin biosynthesis was obtained from gene disruption experiments. Three fragments, internal to the three ORFs and indicated in Fig. 2, were cloned into the mobilizable vector pCIB132 and introduced by conjugation from E. coli S17-1 into M. xantbtcs DM504/15, the saframycin producer (Pospiech e t a/., 1995). The pCIB132 derivatives cannot replicate autonomously in M. xantbus, but they can integrate into the chromosome by homologous recombination to give kanamycin-resistant transcon jugants at a frequency of about 1O r ' per recipient cell. Saframycin production, determined using the biotest and HPLC analysis, was abolished in all tested transconjugants (number of transconjugants in biotest : 10 for s a f A , 36 for s a p , 17 for safC; number of transcon jugants in HPLC analysis : 3 for s a f A , 3 for s a p , 6 for safC). These results are consistent with, but do not prove, involvement of the three safgenes in antibiotic production. Cross-feeding experiments The above s a f A , s a p and safC mutant strains were used for cross-feeding studies designed to detect the existence of diffusible saframycin Mxl precursors. Mixed culture of the s a f A and s a p mutant strains, presumably lacking peptide synthetase activity, did not result in antibiotic production. Mixed growth of either of these strains with the safC mutant strain resulted in a 4 mm inhibition zone, indicating a low but significant level of saframycin biosynthesis. The DM504/15 control gave an inhibition zone of 12 mm. When the safC mutant strain was grown near the s a f A or s a p mutant strain, antibiotic appeared near the former, indicating that the safC strain converted a precursor secreted by the peptide-synthetase-deficient strain. Therefore, the peptide synthetases probably use methylated amino acid derivatives either as natural substrates or as alternative substrates. Conclusions The two putative peptide synthetases SafB and SafA (Fig. 2) involved in saframycin Mxl biosynthesis contain two amino-acid-activating domains each, consistent with the hypothetical linear tetrapeptide structure of the saframycin precursor. The first domain, S a m l , probably responsible for activating the amino-terminal alanine, lacks the usually well-conserved peptide synthase core sequence 1, and the last domain, SafA3, has attached a putative reductase function, possibly involved in the modification of the carboxy-terminal tyrosine. Both of these domains represent new types of amino-acidactivating domains. The targeted gene disruptions, together with the crossfeeding experiments, proved the involvement of the three sequenced ORFs in saframycin biosynthesis. The crossfeeding experiment using strains growing close together rather than mixed indicated that the putative 0methyltransfrerase encoded by safC presumably modifies tyrosine before it becomes a substrate for the peptide synthetase. This, of course, has implications for the possible use of the saframycin peptide synthetase modules for the construction of recombinant peptide synthetases for the synthesis of new metabolites as pioneered by Stachelhaus e t a/. (1995). ACKNOWLEDGEMENTS We thank J. Heim for supporting the project, and K. Hess and H. B. Jenny for performing HPLC analysis. REFERENCES Arai, T., Takahashi, K. & Kubo, A. (1977). New antibiotics, saframycins A, B, C, D, and E. J Antibiot 30, 1015-1018. Arai,T., Takahashi, K., Ishiguro, K. & Mikami, Y. (1980). Antitumor antibiotics, saframycin A and C. Gann 71, 790-796. Black, T. A. & Wolk, C. P. (1994). Analysis of a Het- mutation in Anabaena sp. strain PCC7120 implicates a secondary metabolite in the regulation of heterocyst spacing. J Bacterioll76, 2282-2292. Cosmina, P., Rodriguez, F., de Ferre, F., Grandi, G., Perego, M., Venema, G. & van Sinderen, D. (1993). Sequence and analysis of the genetic locus responsible for surfactin synthesis in Bacillus subtih. Mol Microbial 8, 821-831. Devereux, J., Haeberli, P. & Smithies, 0. (1984). A comprehensive set of sequence analysis programs for the VAX. Nucleic Acids Res 12, 387-395. Donadio, 5. & Katz, L. (1992). Organization of the enzymatic domains in the multifunctional polyketide synthase involved in erythromycin formation in Saccharopobspora eytbraea. Gene 111, 51-60. D'Souza, C., Nakanno, M. M., Corbell, N. & Zuber, P. (1993). Aminoacylation site mutations in amino acid-activating domains of surfactin synthetase : effects on surfactin production and competence development in Bacillus subtilis. J Bacterioll75, 3502-351 0. Downloaded from www.microbiologyresearch.org by IP: 88.99.165.207 On: Sun, 18 Jun 2017 14:40:59 745 A. P O S P I E C H , J. B I E T E N H A D E R a n d T. S C H U P P Gocht, M. & Marahiel, M. A. (1994). Analysis of core sequences in the D-Phe activating domain of the multifunctional peptide synthetase TycA by site-directed mutagenesis. J Bacteriof 176, 2654-2662. Hara, 0. & Hutchinson, C. R. (1992). A macrolide 3-0acyltransferase gene from the midecamycin-producing species Sfreptomyces mycarofaciens. J Bacteriof 174, 5141-5144. Sambrook, J., Fritsch, E. F. & Maniatis, T. (1989). MofecztfarCloning, a Laborat09 Manual. Cold Spring Harbor, N Y : Cold Spring Harbor Laboratory. Sanger, F., Nicklen, 5. & Coulson, A. R. (1977). DNA sequencing with chain terminating inhibitors. Proc Natf Acad Sci US2474, 5463-5467. Schlumbohm, W., Stein, T., Ullrich, C., Vater, J., Krause, M., Marahiel, M. A,, Kruft, V. & Wittmann-Liebhold, B. (1991). An active serine is involved in covalent substrate amino acid binding at each reaction center of gramicidin S synthetase. J Biof Chem 266, Hori, K., Yamamoto, Y., Minetoki, T., Kurotsu, T., Kanda, M., Miura, S., Okamura, K., Furujama, 1. & Saito, Y. (1989). Molecular cloning and nucleotide sequence of the gramicidin S synthetase 1 gene. J Biochem 106, 639-645. 23135-23141. Irschick, H., Trowitzsch-Kienast, W., Gerth, K., Hefle, G. & Reichenbach, H. (1988). Saframycin Mxl, a new natural saframycin isolated from a myxobacterium. J Antibiot 41, 993-998. Schmitt, D., Pakusch, A. E. & Matern, U. (1991). Molecular cloning, induction, and taxonomic distribution of caffeoyl-CoA-3-0methyltransferase, an enzyme involved in disease resistance. J Biof Ishiguro, K., Sakiyama, S., Takahashi, K. & Arai, K. (1978). Mode of action of saframycin A, a novel heterocyclic quinone antibiotic. Inhibition of RNA synthesis in vivo and in vitro. Biochemistcy 17, 2545 2550. Ishiguro, K., Takahashi, S., Yazawa, K., Sakiyama, S. & Arai, K. (1981). Binding of saframycin A, a heterocyclic quinone anti-tumor antibiotic to DNA as revealed by the use of the antibiotic labeled with [“C]-tyrosine or [14C]-cyanide.J Biof Chem 256, 2162-2167. Kagan, R. M. & Clarke, 5. (1994). Widespread occurrence of three sequence motifs in diverse S-adenosylmethione-dependent methyltransferases suggests a common structure for these enzymes. Arch Biochem Biopbyys 310, 41 7-427. Kishi, K., Yazawa, K., Takahashi, K., Maeda, A. & Arai, K. (1984). Structure-activity relationships of saframycins. J.Antibiot 37, 847-852. Kleinkauf, H. & von Dt)hren, H. (1990). Nonribosomal biosynthesis of peptide antibiotics. Eztr J Biochem 192, 1-15. Lown, 1. W. , Joshua, A. V. & Lee, 1. 5. (1982). Molecular mechanisms of binding and single-strand scission of desoxyribonucleic acid by the antitumor antibiotics saframycin A and C. Biochemisty 21, 419-428. Marahiel, M. A. (1992). Muitidomain enzymes involved in peptide synthesis. FEBS Lett 307, 40-43. Morris, M. E. & Jinks-Robertson, S. (1991). Nucleotide sequence of the LYS2 gene of Saccharomyces cerevisiae : homology to Bacillus (brevis tyrocidine synthetase 1. Gene 98, 141-145. Pavela-Vrancic, M., Pfeifer, E., van Liempt, H., Schafer, H.-J.,. von Ddhren, H. & Kleinkauf, H. (1994a). ATP-binding in peptide synthetases : determination of contact sites of the adenine moiety by photoaffinity labeling of tyrocidine synthetase I with 2azidoadenosine triphos phate. Biochemist9 33, 6276-6283. Pavela-Vrancic, M., Pfeifer, E., SchrMer, W., von Dahren, H. & Kleinkauf, H. (1994b). Identification of the ATP-binding site in tyrocidine synthetase I by selective modification with fluorescein 5’isothiocyanate. J Biof Chem 169, 14962-14966. Pospiech, A,, Cluzel, B., Bietenhader, 1. & Schupp,T. (1995). A. new ~ ~ x o c o c c zxanthw ts gene cluster for the biosynthesis of the antibiotic saframycin Mxl encoding a peptide synthetase. hficrobiology 141, 1793-1 803. Reichenbach, H., Gerth, K., Irschik, H., Kunze, B. & Ht)fle, G. (1988). Myxobacteria: a source of new antibiotics. Trends Biotwhnol 6, 115-121. 746 Chem 266, 17416-17423. Simon, R., O’Connell, M., Labes, M. & PUhler, A. (1986). Plasmid vectors for the genetic analysis and manipulation of rhizobia and other Gram-negative bacteria. Methods EnZymof 118, 643-659. Simon, R., Priefer, U. & PUhler, A. (1983). A broad host range mobilization system for in vivo genetic engineering : transposon mutagenesis in gram negative bacteria. Bio/ Technology 1, 784-791. Stachelhaus, T. & Marahiel, M. A. (1995). Modular structure of genes encoding multifunctional peptide synthetases required for non-ribosomal peptide synthesis. F E M S Microbiol Lett 125, 3-14. Stachelhaus, T., Schneider, A. & Marahiel, M. A. (1995). Rational design of novel peptide antbiotics by targeted replacement of bacterial and fungal domains. Science 269, 69-72. Stein, T., Vater, J., Kruft, V., Wittmann-Liebold, B., Franke, P., Panico, M., Dowell, R. M. & Morris, H. R. (1994). Detection of 4’phosphopantetheine at the thioester binding site for L-valine of gramicidin S synthetase 2. FEBS Lett 340, 39-44. Tohika, K., Hori, K., Kurotzu, T., Kanda, M. & Saito, Y. (1993). Effect of single base substitutions at glycine-870 codon of gramicidin S synthetase 2 gene on proline activation. J Biochem 114, 522-527. Trowitzsch-Kienast, W., Irschick, H., Reichenbach, H., Wray, V. & Ht)fle, G. (1988). Isolierung und Strukturaufklarung der Saframycine Mxl und Mx2, neue antitumor-aktive Antibiotika aus Myxococcw xanthtls. Liebigs A n n Chem 475-481. Turgay, K., Krause, M. & Marahiel, M. A. (1992). Four homologous domains in the primary structure of GrsB are related to domains in a superfamily of adenylate-forming enzymes. Mof Microbiol 6, 529-546. Vollenbroich, D., Kluge, B., D’Souza, C., Zuber, P. & Vater, 1. (1993). Analysis of a mutant amino acid-activating domain of surfactin synthetase bearing a serine-to-alanine substitution at the site of carboxylthioester formation. FEBS Lett 325, 22&224. Weber, J. M., Schoner, B. & Losick, R. (1989). Identification of a gene required for the terminal step in erythromycin A biosynthesis in Saccharopobspora eythraea. Gene 75, 235-241. Weckermann, R. W., FUrbaB, R. & Marahiel, M. A. (1988). Complete nucleotide sequence of the &A gene coding the tyrocidine I synthetase from Bacillzis brevis. Ntlcleic Acids Res 16, 11841. Received 6 December 1995; accepted 23 January 1996. Downloaded from www.microbiologyresearch.org by IP: 88.99.165.207 On: Sun, 18 Jun 2017 14:40:59