Survey
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
Fill in the blanks ! A.-F. Miller, 2008, pg 1 microreview Primary structure of a protein: ADNLAVQRLNDYHVS Secondary structure: α helical, β strands (↑↓ or ↑↑) 2er structure is stabilized by interactions of the backbone. However the side chains do favour one or another (or neither) 2er structure. Tertiary structure arises from packing together of 2er structural elements, and sequestration of hydrophobic side chains away from water, to form a hydrophobic core. A few motifs are particularly common (evolutionarily successful). A.-F. Miller, 2008, pg 2 Extra Information on 1er str. The amino acid sequence (1er str.) of one protein has been aligned with that of another by a “BLAST” search. Thus we learn that the Fe-superoxide dismutase of E. coli is identical at most positions to that of the chloroplast of B. unguicolata. Top line = E. coli, middle = identities, bottom = B. unguiculata. Query= gi|169955|gb|AAA33960.1| Fe-superoxide dismutase Length=248 >gi|29466958|dbj|BAC66946.1| unguiculata] Length=211 chloroplastic iron superoxide dismutase [Barbula Score = 262 bits (669), Expect = 1e-68, Method: Composition-based stats. Identities = 124/214 (57%), Positives = 158/214 (73%), Gaps = 18/214 (8%) Query 28 Sbjct 12 Query 88 Sbjct 72 Query 148 Sbjct 132 Query 208 A.-F. Miller, 2008, pgSbjct 3 174 ELKPPPYPLNGLEPVMSQQTLEFHWGKHHKTYVENLKKQVVGTELDGKSLEEIIVTSYNK +L+PPPY L+ LEP MS++TLE+HWGKHH+ YV+NLKKQ+ GTEL ++LE+I+ +YN DLRPPPYALDALEPHMSKETLEYHWGKHHRAYVDNLKKQIEGTELASQTLEDIVRATYNN 87 GDILPAFNNAAQVWNHDFFWECMKPGGGGKPSGELLELIERDFGSFVKFLDEFKAAAATQ G+ FNNAAQ WNH+FFW M P GG +P GEL+ L++RDFGS+ F+ EFK A ATQ GEPTAPFNNAAQAWNHEFFWLSMSPHGGKQPDGELMSLLKRDFGSYDNFVKEFKQAGATQ 147 FGSGWAWLAYRARKFDGENVANPPSPDEDNKLVVLKSPNAVNPLVWGGYYPLLTIDVWEH FGSGWAWL D KL+V KSPNA+NPLV+ G+ P+L DVWEH FGSGWAWLTV-----------------ADGKLMVEKSPNAINPLVF-GHVPILVADVWEH 207 AYYLDFQNRRPDYISVFMDKLVSWDAVSSRLEQA AYYLD+QNRRPDY++ FM++LVSWDAV+ RL+ A AYYLDYQNRRPDYLTTFMNELVSWDAVAKRLQLA 241 207 71 131 173 Tertiary structural models 4-helix bundle β-sandwich TIM barrel Fatty Acid Binding Protein. Hemerythrin A.-F. Miller, 2008, pg 4 Triose Phosphate Isomerase Quaternary structure Hemoglobin, G&G Fig 5.9 A.-F. Miller, 2008, pg 5 Hemerythrins from marine worms. Fig. 6.48 of Garrett & Grisham Thermodynamic bases for protein folding Unfolding is highly cooperative. A.-F. Miller, 2008, pg 6 Nucleobases: the variable units of nucleic acids For nucleotides, phosphate pK1 ≈ 1, pK2 ≈ 6 A.-F. Miller, 2008, pg 7 Nucleo bases Figs. 10.2, .3, .4 of Garrett & Grisham RibonucleotiDes, (inc. 1 phosphate) RNA: U and 2' OH DNA: T and 2' deoxy A.-F. Miller, 2008, pg 8 Fig. 10.13 of Garrett & Grisham polynucleotide chains DNA is slightly more labile. Which one is RNA ? A.-F. Miller, 2008, pg 9 5’-3’ phosphodiester linkages. Polymer grows from 3’ OH (in general) Watson-Crick base pairs Major groove Minor groove Exposed functionalities differ for different base pairs. Base stacking stabilizes double-helical secondary structure, Base pairing provides fidelity in replication and transcription. A.-F. Miller, 2008, pg 10 Fig. 10.20 of Garrett & Grisham Antiparallel double helix A.-F. Miller, 2008, pg 11 Different forms of NA A.-F. Miller, 2008, pg 12 Fig. 11.10 of Garrett & Grisham A.-F. Miller, 2008, pg 13 Fig. 11.10 of Garrett & Grisham A.-F. Miller, 2008, pg 14 Fig. 11.10 of Garrett & Grisham A.-F. Miller, 2008, pg 15 Tertiary structure of RNA Coaxial stacks of bases from the bases of different stem-loops. Pseudoknots: H-bonding between loop bases and nearby SS-RNA. Ribose zippers: H-bonds between 2’OH groups of ribose in antiparallel SS strands. Mg2+ binding, NEXT. Three-base H-bonding. 11.34 A.-F.Fig. Miller, 2008, pgof Garrett 16 & Grisham