Survey
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
Are Viruses Alive? Patrick Forterre Université Paris-Sud (Institut de Génétique et Microbiologie) Institut Pasteur (Département de Microbiologie) David Prangishvili Spiraviridae Are Viruses Alive? Is it an important issue? Most virologists assume « implicitely » that viruses are alive They commonly speak of the « virus life cycle » in their papers Most biologists don’t care…………..many of them even don’t care about viruses at all!! Biologists with philosophic background (and/or interested in exobiology) usually consider that viruses are not living (Marc Vanregenmortel, Michel Morange, Purificacion Lopez-Garcia, David Moreira, Antonio Lazcano, Testart) Michel Morange Problems raised by the definition of life, In « Origins and evolution of life, an Astrobiology perspective », pp3-13 Gargaud, Lopez-Garcia and Martin, eds. Cambrige University press, 2011 Introduction: « I will show that the recent suggestion that viruses are alive makes no sense and obscures discussions about life » « Examining the case of viruses, the absence of a definition leaves us defenceless when absurd statements are made on the living character of such objects » «To consider viruses as living creates much useless confusion » «viruses remain strict parasites » « there is no symmetry between a virocell and a ribocell. The first needs the second: the reverse is not true » There is no symmetrie between carnivors et les herbivors, The first needs the second: the reverse is not true HYPOTHESIS: there is a psychological aspect in this debate We don’t want to be classified in the same category than viruses Ribocentrism «To consider viruses as living creates much useless confusion » (Morange) 513 pages Nothing else on viruses??? To consider viruses as non living, but by-products of life led to ignore them or to underestimate their role in life history My hypothesis: scientists who consider that viruses are not alive tend to underestimate (denigrate) viruses……………and make false statements % of genes in gene clusters of Virus-Plasmid orgin % of genes in gene clusters of unknown origin % other genes Cortez, Forterre and Gribaldo Genome Biology, 2009 6% 81% 13% Ori C a→c→g→a→t About 20% of genes in archaeal and bacterial genomes originated in viruses or plasmids DePerseval and Heidman, Cytogenet Genome Res, 2005 viral origin ? repeated 40% retrovirusderived elements) 8%% retrovirus 2% (exon) eukaryotic genes 15% (introns) Total sequences: 196 kb, 223 genes, 168 different proteins 168 different proteins 103 singletons PAV1 (18) TPV1 (24) pGT5 (3.6) pRT1 (3.4) pTN1 (3.3) pTN2 (13) pP12-1 (12) pT26-2 (25) pAMT11 (20) pTN3 (18) PCIR10 (13) PIRI48 (13) pEXT9a (10,5) pIRI33 (11) pAMT7 (8.5) 36 proteins with homologue(s) in at least one other plasmid/virus* (6) 59 with homologues in cellular genomes* 58 of them being encoded by genes present in integrated viruses/plasmids (archaeal proteins of viral origin) 1 protein of cellular origin (MCM) •Mostly in Thermococcales or in Methanococcales or Thermococcales, one also in Sulfolobus (integrase), one in an Haloarchaeal plasmid The gene flux from viruses to cells is a very ancient on-going process : a lot of cellular proteins should have a viral origin viruses cells Cells are giant pick-pockets of viral genes Scientists systematically favour transfer from cells to viruses in the interpretation of phylogenetic analyses. Implicit (false) assumption: new genes cannot originated in viral lineages RNA polymerase Ancient cells (fourth domain) Megavirales Boyer et al., Plos One, 2011 Williams et al., Plos One, 2011 Modern cells (Eukaryotes) Ancient Megavirales Megavirales Modern cells (Eukaryotes/Archaea) Many viruses encode DNA replication proteins that are very divergent from their cellular homologues Escherichia coli Topo IV Bacillus subtilis Prochlorococcus marinus Bactéries Deinococcus radiodurans Escherichia coli DNA gyrase Bacteriovirus T4 African Swine Fever (NCLDV) Chilo iridescent virus (NCLDV) Virus Trypanosoma brucei PBCV-1Chorella virus (NCLDV) Plasmodium falciparum Caenorhabditis elegans Encephalitozoon cuniculi Saccharomyces cerevisiae Arabidopsis thaliana Caenorhabditis elegans Homo sapiens Drosophila melanogaster Eukaryotes E Hs Tb LEHILLRPDTYIGSVELVTQQMWVYDEDVG-INYREVTFVPGLYKIFDEILVNAADNKQRDP-KMSC-IRVTMIRKQLISIWNN GKGIP IEHVLTRPEMYIGSLDTTATPMFIYDEQKGHMVWETVKLNHGLLKIVDEILLNASDNISNRSARMTYIRVTITDTGEITIEND GAGIP T4 T4 IEHIKKRSGMYIGSSANETHERFMF----GK--WESVGYVPGLVKLIDEIIDNSVDEGIRTKFKFANK INVTIKKNNQVTVE DNGRGIP Ec Bs LDAVRKRPGMYIGDTDDGT---------------------GLHHMVFEVVDNAIDEAL---AGHCKE IIVTIHADNSVSVQ DDGRGIP LEAVRKRPGMYIGSTNSK----------------------GLHHLVWEIVDNSIDEAL---AGYCTD INIQIEKDNSITVV DNGRGIP B Type IIA DNA Topoisomerase s Topo IB DNA topoisomerases Poxviridae Brochier-Armanet, Gribaldo, Forterre, Biology Direct, 2008 Bacteria Eucarya Archaea Indiani and O'Donnell Nature Reviews Molecular Cell Biology 7, 751–761 (October 2006) | doi:10.1038/ nrm2022 | Bacteria Baculovirus Archaea/ Eukarya NCLDV Herpes T4 One transfer before LUCA followed by a non-orthologous replacement in bacteria Forterre, P. Current Opinion in Microbiol. 2002 ancient virosphere a DNA-LUCA? BACTERIA ARCHAEA EUKARYA We know that many viruses have « invented » new forms of DNA C DNA HMC HMC-DNA To protect their genomes against nucleases encoded by their cellular « hosts Hypothesis: RNA viruses have invented DNA to protect their genomes. exactly as some modern viruses have modified their DNA. ThyA RNA U-DNA RNR T-DNA HMC-DNA ThyA-like If this is true, viruses have played a major role in the origin and evolution of modern cells My hypothesis: scientists who consider that viruses are not alive tend to underestimate (denigrate) viruses……………and make false statements The double-jelly-roll fold The PRD1/Adenovirus lineage The Hong-Kong fold The HK97 lineage Viruses are ancient and co-evolved with their victims, (hosts?) Prangishvili, Forterre and Garrett, Nature Rev Microbiol. 2006 It’s not because scientists who consider that viruses are not alive tend to underestimate them……………that viruses are alive!!!! Metagenomic and genomic analyses data have shown that most genetic information in the biosphere is probably present in viral genomes and derived elements (plasmids) If viruses are not living, this means that most genetic information on our planet has been created by non living entities!! Viruses and related elements (plasmids) are the major source of variations by manipulating genomes and creating new functions Viruses put an enormous selection pressure. They control the number and type of cells in natural environments…… Viruses are the major agents of natural selection Raoult D. and Forterre, P. Nature Rev Microbiol, 2008 Ribosomes Encoding Organisms Capsid Encoding Organisms If you get the sequence of a 1 Mb genome from metagenomic data, this definition allows you to distinguish between cellular and a viral genomes Krupovic and Bamford, J Virol 2010 A virus is defined by its capsid (the viral self sensu Bamford) Raoult D. and Forterre, P. Nature Rev Microbiol, 2008 Ribosomes Encoding Organisms Capsid Encoding Organisms If you get the sequence of a 1 Mb genome from metagenomic data, this definition allows you to distinguish between cellular and a viral genomes are viruses organisms? are viruses alive? No, if we confuse the virus with the virion Viruses (virions) are inert until they encounter cells, they have no metabolism, they cannot produce energy Viruses (virions) can cristallize (Tobacco mosaic virus) Viewed in TV Chamberlain’s filter (1884) VIRUSES and GENES Jacob and Wollman Scientific American. 1961 Jun;204:93-107, A virus may exist in three states: -the extracellular infectious state -the vegetative state of autonomous replication -the proviral state » «A virus can be considered a genetic element enclosed in a protein coat » This traditional view of “viruses as virions” has been criticized by Claudiu Bandea in 1983 and more recently by Jean-Michel Claverie The virus should not be confused with the virion Claudiu Bandea (Journal of Theoretical Biology, 1983) Bandea: The living phase of the virus is the intracellular phase of its life cycle Claverie: The virus is the viral factory Jean-Michel Claverie (Genome Biology, 2006) The viral factory reorganize cell metabolism, energetic, and all cell synthetic functions to produce virions Mimivirus viral factory reorganize cell metabolism, energetic, and all cell synthetic functions to produce virions This is not a virus This are not Humans This is a virus These are Humans Origin of the eucaryotic nucleus Takemura, J. Mol. Evol. 2001 Bell, J. Mol. Evol. 2001 Viral factory the Nucleus of a virocell nucleus But…..the concept of viruses as viral factory cannot be generalized because viruses infecting archaea and bacteria dont produce obvious viral factories The virus transforms the cell into a viral factory (Lwoff, 1961) André Lwoff The virus transforms the cell into a virion factory The organismal form of the virus is the virion factory Forterre and Prangishvili, Research in Microbiology (2009) Ann N Y Acad Sci. , (2009) The organismal form of the virus corresponds to the infected cell, which has been transformed into a new organism = a virocell The virocell: a cell whose dream is not to produce two cells but to produce virions The virion : a vehicle to disseminate viral genes The virocell : the living form of the virus Ribosome encoding organisms (REO) ribocells Reproduce by cell division Capsid encoding organisms (CEO) : virocells Reproduce by production of virions Cells producing virions but that can still divide are « ribovirocells » The virocell should not be confused with the virus The virocell corresponds to one « existential state of the virus » A virus may exist in three states: -the extracellular infectious state -the vegetative state of autonomous replication -the proviral state » Some viruses can infect different hosts, forming different types of virocells One should not confuse cells and organisms Mamavirus Amoeba Sputnik Bacteria A dynamic RiboVirocell Forterre: Giant viruses: conflict in revisiting the virus concept Intervirology, in press (2010) A cell can harbor several different living organisms A living organism is always associated to one evolutionary lineage with an history that can be represented by a tree-like structure Mamavirus Amoeba Sputnik Bacteria marc van regenmortel Some viruses that infect cyanobacteria and degrade their chromosomes encode proteins involved in photosynthesis to replace those of the cell A photosynthetic virocell Braggs and Chisholm, Plos One, 2008 Virions of photosynthetic viruses Genome can be amplified in the virocell from 100 to 1000 times Mew viral genes (proteins) can originate by: point mutations, duplication, recombination, slippage, frameshift, overlapping Viruses are not only vehicules of cellular genes New proteins also originated in viral lineages Virus-first hypotheses for the origin of life cannot be correct Viruses cannot have appeared before cells……since they are cells themselves But of course viruses might have appeared before modern cells, i.e. before LUCA Schematic history of life Origin of Life (first « cell ») First RNA cell « invention » of the ribosome First RNA-Protein cell ORIGIN OF VIRUSES LUCA « invention » of DNA Eukarya Archaea Bacteria A simple hypothesis for the origin of viruses: the ancient escape hypothesis Different mechanisms triggered the formation of different types of virions to disseminate RNA genomes in the late RNA world (after the invention of proteins). Some ribocells became ribovirocells and later on virocells Forterre and Krupovic, the origin of virocell, book chapter, in press Viruses are evolved by cells Moreira and Lopez-Garcia, Nature Rev microbio (2009) Viruses evolved within cells (in the virocell) Violent reactions to the virocell concepts « conceptual trick » « artifice» «epistemological cheating» The remore indeed does not transform the shark into a remorashark…!!!!! The remore stay outside!!!! Very different from the virus situation A more interesting example: Chlamydiae The cellular structure of the Chlamydiae is conserved all along its life cycle Unlike viruses, he Chlamydiae (a ribocell) does not borrow the cellular structure of its victim Viruses have unique life cycle properties that justify the class them in a categorie different from any other types of cellular parasite (capsid encoding organisms) What is life? It’s not a scientific question It’s a philosophical question We need a philosophical framework My personal philosophical framework Life is the mode of existence of albuminoïd bodies Friederich Engels (Dialectics of nature, 1883) Life is the mode of existence of living organisms So…what is a living organisms ? Two approaches: We decide what is a living organism and We look if specific biological entities (viruses?) fit with our definition We decide which biological entities are living and we propose a definition based on their properties 2008 : A collection of integrated organs (molecular machines) producing individuals evolving through natural selection 2012 A living organism should belong to a evolutionary lineage characterized by a life cycle with at least one cellular phase Life ? ? ? Are plasmids living organisms ? This is not a bacterial penis, but a plasmid made dissemination system Plasmids are only made of nucleic acid. They probably originated from viruses that lost their capsid Bacteria have no sex! It’s a mode of plasmid dissemination