• Study Resource
  • Explore Categories
    • Arts & Humanities
    • Business
    • Engineering & Technology
    • Foreign Language
    • History
    • Math
    • Science
    • Social Science

    Top subcategories

    • Advanced Math
    • Algebra
    • Basic Math
    • Calculus
    • Geometry
    • Linear Algebra
    • Pre-Algebra
    • Pre-Calculus
    • Statistics And Probability
    • Trigonometry
    • other →

    Top subcategories

    • Astronomy
    • Astrophysics
    • Biology
    • Chemistry
    • Earth Science
    • Environmental Science
    • Health Science
    • Physics
    • other →

    Top subcategories

    • Anthropology
    • Law
    • Political Science
    • Psychology
    • Sociology
    • other →

    Top subcategories

    • Accounting
    • Economics
    • Finance
    • Management
    • other →

    Top subcategories

    • Aerospace Engineering
    • Bioengineering
    • Chemical Engineering
    • Civil Engineering
    • Computer Science
    • Electrical Engineering
    • Industrial Engineering
    • Mechanical Engineering
    • Web Design
    • other →

    Top subcategories

    • Architecture
    • Communications
    • English
    • Gender Studies
    • Music
    • Performing Arts
    • Philosophy
    • Religious Studies
    • Writing
    • other →

    Top subcategories

    • Ancient History
    • European History
    • US History
    • World History
    • other →

    Top subcategories

    • Croatian
    • Czech
    • Finnish
    • Greek
    • Hindi
    • Japanese
    • Korean
    • Persian
    • Swedish
    • Turkish
    • other →
 
Profile Documents Logout
Upload
Science SMSC statement
Science SMSC statement

... Investigating the effects of Science on their lives and how the rights of others Investigating the beneficial may be affected by and harmful effects of pollution, for example. research and discoveries in Science. Discussing personal health issues linked to Evaluating to what extent smoking, poor die ...
Nonfiction-Lesson 2
Nonfiction-Lesson 2

... • Biologist: is someone who studies living things and the way they live and grow. • Prefix: bio – means “life” • Suffix: -logy – means “the study of” • Suffix: -ist – means “one who does or is an expert in” • A related words: ...
Look older? Might be your genes, study says
Look older? Might be your genes, study says

... Earlier research pointed to pieces of the genetic code related to spotty skin and to the damage wrought by sun exposure. But the scientists behind the new finding wanted to study the genetics of “perceived age,” the age a person looks to others, says study co-author David Gunn, a scientist at Unilev ...
Sociology - The Hazeley Academy
Sociology - The Hazeley Academy

... Sociology is a stimulating and challenging subject. A simple definition is that it is ‘the study of the world around us’. Sociologists however, do not just measure and observe the world; they try to understand how people live and interact in certain ways. In order to achieve this understanding it is ...
types of studies in diabetes epidemiology
types of studies in diabetes epidemiology

... – Is first line of epidemiologic research ...
leaflet - University of Nottingham
leaflet - University of Nottingham

... identify changes in DNA which predispose to pre-eclampsia. It’s called the InterPregGen study because it’s international, it’s about pregnancy, and it’s studying genes. There is good evidence for inherited factors – a woman whose mother had preeclampsia is three times more likely than other women to ...
TYPES OF STUDIES IN DIABETES EPIDEMIOLOGY
TYPES OF STUDIES IN DIABETES EPIDEMIOLOGY

... – Is first line of epidemiologic research ...
Dr Juliane Kaminski Max Planck Institute for Evolutionary
Dr Juliane Kaminski Max Planck Institute for Evolutionary

... capacities are widely referred to and summarized with the term “Theory of mind”. One goal in comparative psychology is to investigate to which degree the cognitive capacities underlying these human skills are uniquely human or shared at least to some degree with other species. This might help us to ...
Study Guide
Study Guide

... All organisms share certain characteristics. ...
Summative Assessment Unit 1 Psychology Definitions and Matching
Summative Assessment Unit 1 Psychology Definitions and Matching

... 21.) The principle of natural selection maintains that…. A). The genes that are most likely to be passed on to future generations are those that contribute to survival B). We share 99.9 percent of our genetic makeup C). The extent to which variation exists among individuals is a function of their g ...
Zoology_Introduction
Zoology_Introduction

... more closely related two organisms are to each other, the more similar is their DNA ...
What determines gene expression
What determines gene expression

... so the physical differences in men are viewed as a major difference between men and women. However, it is society’s responsibility to establish an equal foundation where biology and genetics are balanced when comparing the sexes. Therefore, if men get privileges for being physically stronger or fast ...
Procyon lotor - Coosa High School
Procyon lotor - Coosa High School

... more closely related two organisms are to each other, the more similar is their DNA ...
BIOLOGY-H/Pre-IB
BIOLOGY-H/Pre-IB

... Protein Synthesis Crossword Puzzle / (20) ...
File - Mrs. Abascal`s 6th Grade World History Class
File - Mrs. Abascal`s 6th Grade World History Class

... ò  Fossils are the remains of plant and animals that have been preserved from an earlier time ò  Example: Jurassic Period ...
Ethical Arguments in Re-studying the Human Remains: the dead vs
Ethical Arguments in Re-studying the Human Remains: the dead vs

... at the end times ...
Unit 1 PowerPoint Notes
Unit 1 PowerPoint Notes

... = early school of thought promoted by Wundt and Titchner; used introspection to reveal the structure of the human mind. ...
mathlgwlflgmllriifplasaklvtppnmteldtrfptdcfnrtsfppdf
mathlgwlflgmllriifplasaklvtppnmteldtrfptdcfnrtsfppdf

... of microbial strains and try to extend their capacity to help agriculturally important plants to improve growth and yield under desert-like conditions. It is believed that the gained knowledge from the DARWIN-XXI program should help to reestablish sustainable agricultural systems in many regions of ...
Chapter 1 Overview
Chapter 1 Overview

... language. 9. Although race was once defined as a biological category, it is actually a social construction, an idea that is built on shared perceptions, not on objective reality, and, unlike genetic differences, social constructions can change. 10. The value of an interdisciplinary approach to under ...
PeDRA Study Approval Form
PeDRA Study Approval Form

... Web: www.pedraresearch.org ...
Exam 2 Study Guide - Montgomery College
Exam 2 Study Guide - Montgomery College

... BIOL 114 Understanding Viruses Study Guide Exam 2 Prof. Lester Do all of the study objectives at the end of each lecture handout. Study and then try to answer them. If you cannot answer them without looking at the notes, you need to study more. Write out the answers. Writing helps you to learn. List ...
The World History Association (WHA)
The World History Association (WHA)

... Although it is important for students of world history to have a deep and nuanced understanding of each of the various cultures, states, and other entities that have been part of the vast mosaic of human history, the world historian stands back from these individual elements in that mosaic to take i ...
world his study guide ch 1-3
world his study guide ch 1-3

... All human beings today belong to the australopithecines subspecies of human beings. The Paleolithic Age is the period in which humans used simple stone tools. The real change in the Neolithic Revolution was the shift from hunting and gathering to systematic agriculture. The ability to acquire food o ...
WHATCOM COMMUNITY COLLEGE
WHATCOM COMMUNITY COLLEGE

... expected format and citation methods on long report, and present written material clearly. 2. Demonstrate thinking skills by analyzing what is presented in class, reasoning beyond basic concepts, and using materials presented to reach new conclusions. 3. Demonstrate quantitative reasoning in the int ...
Exploring Unit 4 VCE Biology
Exploring Unit 4 VCE Biology

...  Highlight key words  Are there words you don’t understand? Discuss what they might mean and set up a glossary at the front of your books  What does your group feel they are most comfortable with? Concerned with? Interested in learning about? Aren’t interested in learning about?  Elect one group ...
< 1 ... 7 8 9 10 11 >

Biohistory

Biohistory is a relatively new school of historiography although its development can be found in the late nineteenth century. Biohistory is defined, according to biohistorian Stephen Boyden, as a ""coherent system of knowledge, or field of study, which reflects the broad sequence of happenings in the history of the biosphere and of civilization, from the beginning of life to the present day.""For the historians who study under this school, one of the main principles is the understanding the relationship of the biosphere, the total collection of Earth’s ecosystems combined and various human elements, including cultural adaptations and the impact of biological forces on society. One of the things that make biohistory unique is that the ""starting point is the history of life on Earth, and the basic principles and facts of evolution, genetic inheritance, ecology, and physiology. Next, it turns to consider the evolutionary background, biology and innate sensitivities of the human species, and the emergence in evolution of the human aptitude for culture.""Biohistory emerged from several different schools and disciplines including the Annales school, environmental history, human geography, and sociobiology as well as Darwinian Theory. However, there are biohistorians who work towards eliminating affiliation with Darwinian Theory, especially Social Darwinism, in order to reduce critiques of biological determinism.A similar concept to biohistory, evolutionary biology is different because it only takes into account the scientific aspects of phenomena and not the historical implications.As of 2010, the American Historical Association (AHA) has not accepted biohistory as a legitimate historiographical school of study, though there are academic scholars who study under it. However, for over one hundred years, there have been statements given that suggest an eventual acceptance of the main tenets of biohistory as a basis for future historical research and scholarship. The term biohistory has contested origins because many scholars who write on the topic claim to have coined it.
  • studyres.com © 2026
  • DMCA
  • Privacy
  • Terms
  • Report